IFN-gamma Protein, Rat (CHO)
Based on 1 Customer Validation
IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.
- Species: Rat
- Source: CHO
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
IFN-gamma Protein, Rat (CHO) is a pro-inflammatory cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties.
Background
Interferon-gamma (IFN-γ) is a cytokine with potent immunomodulatory, anti-proliferative, and antiviral properties. IFN-γ activates cells via a different receptor than IFN-α and IFN-β, which accounts for the different physiological properties of the proteins. Production of IFN-γ is largely restricted to activated CD4+ TH1 T cells, CD8+ T cells, and natural killer cells. One of the most important consequences of IFN-γ secretion is the activation of macrophages. In addition, IFN-γ plays a central role in inflammatory responses by activating endothelial cells, promoting TH1 cell development and cellular immune responses, and up-regulation of major histocompatability complex protein expression on antigen-presenting cells[1].
Verified Bioactivity
1. The ED50 is <2.5 ng/mL as measured by WEHI-279 cells, corresponding to a specific activity of >4 × 105 units/mg.
2. Measured by its binding ability in a functional ELISA. Immobilized rat IFN gamma at 10 μg/mL (100 μL/well) can bind biotinylated rat IFN gamma R1. The ED50 for this effect is 29.09 ng/mL.
Technical Parameters
-
Species Rat
-
Source CHO
-
Tag Tag Free
-
Accession
P01581 (Q23-C156)
-
Molecular Construction
-
N-term
-
IFN-gamma (Q23-C156)
Accession # P01581 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
IFNG; IMD69; Interferon Gamma; IFG; IFN-Gamma; IFI; Immune Interferon
-
AA Sequence
QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
-
Molecular Weight
Approximately 15-25 kDa, based on SDS-PAGE under non reducing (N) conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS or PBS, pH 7.4, 8% trehalose.
<0.2 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (262 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)