NAP-2/CXCL7 Protein, Rat

Customer Review

Based on 1 Customer Validation

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2. NAP-2/CXCL7 Protein, Rat is produced in E. coli , and consists of 62 amino acids (I46-I107).

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Rat is produced in E. coli , and consists of 62 amino acids (I46-I107).

Background

CXCL7 is an important chemoattractant cytokine, which signals through binding to its receptor CXCR2. Many cells, including leucocytes and stromal cells, express CXCL7. CXCL7 is a potent chemoattractant and activator of neutrophil function[1][2].
CXCL7, a member of the CXC chemokine subfamily, is translated as a proprotein and cleaved into several smaller forms, each with particular functions. In humans, the CXCL7 gene is translated as a 14 kDa proprotein, designated leucocytederived growth factor (LDGF), which is cleaved into several smaller forms, platelet basic protein (PBP), connective tissue activating protein III (CTAP-III) and β-thrombogulin (β-TG), and NAP-2. The longest form, PBP or LDGF, is expressed in platelets and megakaryocytes and is reported to be a fibroblast mitogen. CTAP-III is a 85 amino acid protein and can be converted to 70 amino acid NAP-2 by enzymatic removal of 15 residues. CTAP-III is suggested to support megakaryocyte maturation and platelet production and is involved in resistance to mycobacteria by augmenting reactive oxygen production. NAP-2, the smallest protein in this series, is a neutrophil-activating mediator, stimulating functions such as lysosomal enzyme degranulation, but is reported to inhibit megakaryocytopoiesis[2].
CXCL7 has been demonstrated to participate in a variety of cellular processes, such as DNA synthesis, glycolysis, mitosis, intracellular cAMP accumulation, prostaglandin E2 secretion, as well as the synthesis of hyaluronic acid and plasminogen activator. Moreover, it is also an antimicrobial protein with bactericidal and antifungal activity. Recently, CXCL7 has been found to be deregulated in human cancers, and plays a role in tumor growth. For instance, CXCL7 is found to promote the growth of clear cell renal cell carcinoma. The CXCL7/CXCR2 signaling plays a promoting role in several common malignancies, including lung, renal, colon, and breast cancer[1].

Verified Bioactivity

1. The ED50 is <200 ng/mL as measured by CHO-K1/Gα15/rCXCR2 cells (human Gα15 and Rat CXCR2 stably expressed in CHO-K1 cells).
2. Fully biologically active when compared to standard. Determined by its ability to chemoattract THP-1 cells. The ED50 for this effect is 23.25 ng/mL, corresponding to a specific activity is 4.301×10^3 U/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CXCL7 (I46-I107)
      Accession # Q99ME0
    • C-term
  • Protein Length

    Partial

  • Synonyms

    PPBP; Macrophage-Derived Growth Factor; Prev. THBGB1; C-X-C Motif Chemokine 7; SCYB7; Beta-Thromboglobulin; CTAP3; NAP-2-L1; CXCL7; Small Inducible Cytokine Subfamily B, Member 7; MDGF; Neutrophil-Activating Peptide-2; LDGF; Low-Affinity Platelet Factor I

  • AA Sequence

    IELRCRCTNTLSGIPLNSISRVNVFRPGAHCDNVEVIATLKNGKEVCLDPTAPMIKKIVKKI

  • Molecular Weight

    Approximately 10 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00