1. Recombinant Proteins
  2. Others
  3. SAA1 Protein, Human (His)

SAA1 Protein, a major acute phase protein, forms a homohexamer comprising dimers of trimers. While the native form doesn't spontaneously form amyloid fibrils, partial proteolysis can induce amyloid fibril generation. SAA1 also serves as an apolipoprotein in the HDL complex and shows affinity for heparin. SAA1 Protein, Human (His) is the recombinant human-derived SAA1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE SAA1 Protein, Human (His)

Others
Flow Cytometry
RT-PCR

    SAA1 Protein, Human (His) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2025 Sep 30;44(1):277.  [Abstract]

    Rescue experiments assessing the effect of adding recombinant SAA1 protein (HY-P70510; 200 ng/ml; ; 20–24 h) or the TLR2/4 inhibitor SsnB (Sparstolonin B; HY-116213; 20 µM; 20–24 h) on the ability of A2780 cell supernatants to recruit MDSCs.

    SAA1 Protein, Human (His) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2025 Sep 30;44(1):277.  [Abstract]

    Rescue experiments assessing the effect of adding recombinant SAA1 protein (HY-P70510; 200 ng/ml; ; 20–24 h) or the TLR2/4 inhibitor SsnB (Sparstolonin B; HY-116213; 20 µM; 20–24 h) on the ability of A2780 cell supernatants to recruit MDSCs.

    SAA1 Protein, Human (His) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2025 Sep 30;44(1):277.  [Abstract]

    Rescue experiments assessing the effect of adding recombinant SAA1 protein (HY-P70510; 200 ng/ml; ; 20–24 h) or the TLR2/4 inhibitor SsnB (Sparstolonin B; HY-116213; 20 µM; 20–24 h) on the ability of A2780 cell supernatants to induce GMP differentiation into MDSCs. Data are presented as mean ± SEM from three independent experiments; one-way ANOVA followed by Tukey’s multiple comparisons test.

    SAA1 Protein, Human (His) purchased from MCE. Usage Cited in: J Exp Clin Cancer Res. 2025 Sep 30;44(1):277.  [Abstract]

    IL-1β expression and secretion in MDSCs after adding the TLR2/4 inhibitor SsnB (Sparstolonin B; HY-116213; 20 µM; 20–24 h) to SAA1 (HY-P70510; 200 ng/ml; ; 20–24 h) treatment, detected by qRT-PCR (left) and ELISA (right). Data are presented as mean ± SEM from three independent experiments; one-way ANOVA followed by Dunnett’s multiple comparisons test.
    • Biological Activity

    • Technical Parameters

    • Properties

    • Documentation

    • References

    Description

    SAA1 Protein, a major acute phase protein, forms a homohexamer comprising dimers of trimers. While the native form doesn't spontaneously form amyloid fibrils, partial proteolysis can induce amyloid fibril generation. SAA1 also serves as an apolipoprotein in the HDL complex and shows affinity for heparin. SAA1 Protein, Human (His) is the recombinant human-derived SAA1 protein, expressed by E. coli , with N-6*His labeled tag.

    Background

    SAA1 protein, a major acute phase protein, exists as a homohexamer composed of dimers of trimers. While the native, undenatured form does not spontaneously form amyloid fibrils, partial proteolysis can lead to the generation of amyloid fibrils. Additionally, SAA1 functions as an apolipoprotein within the HDL complex and exhibits an affinity for heparin.

    Biological Activity

    Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is <100 ng/mL.

    • Measured by its ability to chemoattract THP-1 cells. The ED50 for this effect is 53.85 ng/mL, corresponding to a specific activity is 1.857×10^4 U/mg.
    Species

    Human

    Source

    E. coli

    Tag

    N-6*His

    Accession

    AAH07022.1 (R19-Y122)

    Gene ID
    Molecular Construction
    N-term
    6*His
    SAA1 (R19-Y122)
    Accession # AAH07022.1
    C-term
    Protein Length

    Partial

    Synonyms
    Serum Amyloid A-1 Protein; SAA; SAA1
    AA Sequence

    RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAADEWGRSGKDPNHFRPAGLPEKY

    Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

    Purity
    • ≥ 95%, as determined by reducing SDS-PAGE.
    Appearance

    Lyophilized powder

    Formulation

    1.Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl,1 mM EDTA, pH 8.0.
    2.Lyophilized from a 0.22 μm filtered solution of PBS, 8% trehalose, pH 7.4.
    Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

    Endotoxin Level

    <1 EU/μg, determined by LAL method.

    Reconstitution

    It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

    Storage & Stability

    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

    Shipping

    Room temperature in continental US; may vary elsewhere.

    Documentation
    References

    SAA1 Protein, Human (His) Related Classifications

    Help & FAQs
    • Do most proteins show cross-species activity?

      Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

    • Reconstitution Calculator

    • Dilution Calculator

    • Specific Activity Calculator

    The reconstitution calculator equation

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

    Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
    = ÷

    The dilution calculator equation

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

    This equation is commonly abbreviated as: C1V1 = C2V2

    Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
    × = ×
    C1   V1   C2   V2

    The specific activity calculator equation

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

    Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
    Unit/mg = 106 ÷ ng/mL

    Your Recently Viewed Products:

    Inquiry Online

    Your information is safe with us. * Required Fields.

    SAA1 Protein, Human (His)

     

    Requested Quantity *

    Applicant Name *

     

    Salutation

    Email Address *

     

    Phone Number *

    Department

     

    Organization Name *

    City

    State

    Country or Region *

         

    Remarks

    Bulk Inquiry

    Inquiry Information

    Product Name:
    SAA1 Protein, Human (His)
    Cat. No.:
    HY-P70510
    Quantity:
    MCE Japan Authorized Agent: