TARC/CCL17 Protein, Human
Based on 1 Customer Validation
TARC/CCL17 Protein, Human is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Human is a recombinant human TARC/CCL17 (A24-S94) protein expressed by E. coli.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
TARC/CCL17 Protein, Human is the first CC chemokine identified to interact with T cells with high affinity and bind to the CCR4 receptor to mediate inflammation, cancer, and autoimmune related diseases. TARC/CCL17 Protein, Human is a recombinant human TARC/CCL17 (A24-S94) protein expressed by E. coli[1][2].
Background
CCL17, also known as thymic and activating regulatory chemokine (TARC), is a powerful chemokine commonly associated with type 2 immune responses, and its encoding gene is located on chromosome 16 in humans. CCL17 can be produced by thymic and antigen-presenting cells such as dendritic cells, macrophages, and monocytes, and acts by binding to the cell surface chemokine receptor CCR4. CCR4 is a G protein-coupled receptor expressed as a chemokine receptor on Th2 cells, cutaneous lymphocytes skin-localized T cells and regulatory T cells, and also on T cells in adult T-cell leukemia/lymphoma and cutaneous T-cell lymphoma. CCR4 has an important role in the regulation of immune homeostasis and activation of innate immune cells in the central nervous system (CNS). CCL17 plays an important role in the recruitment of CCR4-positive Th2 lymphocytes, is involved in the transport of Th2 cells in eosinophil-associated diseases (including AA and AD) and may be involved in the transport of tumor cells in certain T-cell lymphomas.CCL17 is also thought to be a homeostatic and inducible neuromodulatory chemokine that maintains the typical highly branching morphology of hippocampal microglia under homeostatic conditions and promotes adaptation of microglia morphology to acute LPS-induced neuroinflammation. CCL17 is also associated with autoimmune and allergic disorders[1][2].
In Vitro
CCL17 (0-1 ng/mL) can significantly induce CD4+ CD25+ cell migration, but not CD4+ CD25-cell migration in a dose-dependent manner in the cells purified from regional lymph nodes of gastric cancer patients[3].
CCL17 (10-1,000 ng/mL, 12-48 h) can induce cell migration in human epithelial colon adenocarcinoma cell line HT-29 and is dependent on CCR4-mediated RhoA/Rho-kinase signaling, and CCL17-induced cell migration can be inhibited by preincubation with antibodies against CCR4 or antagonists against CCR4[4].
Verified Bioactivity
1.Full biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/ml.
2.Measured by its ability to enhance Jurkat human lymphoma cells. The ED50 for this effect is 5.681 ng/mL, corresponding to a specific activity is 1.760×105 U/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q92583 (A24-S94)
-
Molecular Construction
-
N-term
-
CCL17 (A24-S94)
Accession # Q92583 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL17; Chemokine (C-C Motif) Ligand 17; Prev. SCYA17; C-C Motif Chemokine 17; TARC; CC Chemokine TARC; ABCD-2; T Cell-Directed CC Chemokine; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 17; A-152E5.3; Thymus And Activation-Regulated Chemokine; C
-
AA Sequence
ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
-
Predicted Molecular Mass
8.1 kDa
-
Molecular Weight
Approximately 9 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
2.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Julien Catherine, et al. What does elevated TARC/CCL17 expression tell us about eosinophilic disorders? Semin Immunopathol. 2021 Jun;43(3):439-458. [Content Brief]
[2]. Jan Korbecki, et al. CC Chemokines in a Tumor: A Review of Pro-Cancer and Anti-Cancer Properties of the Ligands of Receptors CCR1, CCR2, CCR3, and CCR4. Int J Mol Sci. 2020 Nov 9;21(21):8412. [Content Brief]
[3]. Yoshiki Mizukami, et al. CCL17 and CCL22 chemokines within tumor microenvironment are related to accumulation of Foxp3+ regulatory T cells in gastric cancer. Int J Cancer. 2008 May 15;122(10):2286-93. [Content Brief]
[4]. Amr A Al-haidari, et al. CCR4 mediates CCL17 (TARC)-induced migration of human colon cancer cells via RhoA/Rho-kinase signaling. Int J Colorectal Dis. 2013 Nov;28(11):1479-87. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)