1. TGF-beta/Smad Cytoskeleton
  2. TGF-β Receptor Collagen
  3. Endotrophin (Mus musculus) TFA

Endotrophin (Mus musculus) TFA is an adipokine, a cleavage fragment derived from Collagen VI, whose levels are elevated in adipose tissue and breast tumors of obese mice. Endotrophin (Mus musculus) TFA activates the TGF-β signaling pathway and reduces the expression of hormone-sensitive lipase. Endotrophin (Mus musculus) TFA induces adipogenesis, lipid accumulation, fibrosis, inflammation, angiogenesis, adipose tissue expansion, epithelial-mesenchymal transition, and insulin resistance; it also induces Cisplatin (HY-17394) resistance in cancer cells. Endotrophin (Mus musculus) TFA can be used in research related to metabolic diseases such as obesity and type 2 diabetes, as well as cancers such as breast cancer.

For research use only. We do not sell to patients.

Endotrophin (Mus musculus) TFA

Endotrophin (Mus musculus) TFA Chemical Structure

Size Price Stock
1 mg Ask For Quote & Lead Time
5 mg Ask For Quote & Lead Time
10 mg Ask For Quote & Lead Time

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Other Forms of Endotrophin (Mus musculus) TFA:

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

Endotrophin (Mus musculus) TFA is an adipokine, a cleavage fragment derived from Collagen VI, whose levels are elevated in adipose tissue and breast tumors of obese mice. Endotrophin (Mus musculus) TFA activates the TGF-β signaling pathway and reduces the expression of hormone-sensitive lipase. Endotrophin (Mus musculus) TFA induces adipogenesis, lipid accumulation, fibrosis, inflammation, angiogenesis, adipose tissue expansion, epithelial-mesenchymal transition, and insulin resistance; it also induces Cisplatin (HY-17394) resistance in cancer cells. Endotrophin (Mus musculus) TFA can be used in research related to metabolic diseases such as obesity and type 2 diabetes, as well as cancers such as breast cancer[1][2][3].

In Vitro

Endotrophin (Mus musculus) (24 h) TFA upregulates the expression of pro-fibrotic (Col1α1, Tgfβ1, TgfβR2) and pro-inflammatory (Nlrp3, Tlr4) genes in the stromal vascular fraction (SVF) isolated from mouse white adipose tissue (WAT)[1].
Endotrophin (Mus musculus) (24-72 h) TFA induces fibrosis in differentiating 3T3-L1 mouse adipocytes, reduces adiponectin expression, promotes adipogenesis, inhibits lipolysis, and increases lipid accumulation[1].
Endotrophin (Mus musculus) (24 h) TFA upregulates the expression of Lox, pro-inflammatory genes (Il-1β, Tnf-α, F4/80), and M1 macrophage markers (Cd40, Cd86) in primary macrophages isolated from mouse white adipose tissue (WAT)[1].
Endotrophin (Mus musculus) TFA is abundantly secreted in fully differentiated 3T3-L1 adipocytes, whereas no secreted level is detected in 3T3-L1 preadipocytes[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

Endotrophin (Mus musculus) (200 mg/kg; ad libitum; 8 weeks) TFA administration in high-fat diet-fed mice induces local adipose tissue overexpression that promotes adipogenesis, suppresses lipolysis via reduced HSL phosphorylation, enhances lipid accumulation in adipose tissue, and shifts macrophage polarization toward a pro-inflammatory M1 phenotype[1].
Neutralizing antibody against Endotrophin (Mus musculus) TFA neutralizes endotrophin activity in high-fat diet-induced obese mice and significantly improves insulin sensitivity[2].
Overexpression of Endotrophin (Mus musculus) TFA in MMTV-PyMT transgenic mice significantly increases primary tumor volume, promotes the growth of lung metastatic lesions, and restores tumor growth in collagen VI-deficient MMTV-PyMT mice[2].
Induction of Endotrophin (Mus musculus) TFA confers cisplatin resistance in breast tumor-bearing mice, while neutralizing Endotrophin activity or reducing its levels using TZDs restores cisplatin sensitivity[2].
Endotrophin (Mus musculus) TFA induces adipose tissue fibrosis and inflammation in mice, and causes systemic dyslipidemia, hepatic steatosis and insulin resistance; blocking endogenous Endotrophin with neutralizing antibodies effectively reverses these manifestations[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: C57BL/6 (male, 7 weeks old, high-fat diet plus doxycycline-induced adipose tissue-specific overexpression)[1]
Dosage: 200 mg/kg (doxycycline for endotrophin overexpression)
Administration: ad libitum; 8 weeks
Result: Upregulated mRNA levels of adipogenic genes Pparg, Fabp4, Srebp1, and Pref-1 in subcutaneous white adipose tissue (sWAT).
Increased protein levels of PPARγ in sWAT.
Significantly decreased phosphorylated HSL (Ser660) levels in sWAT, while total HSL levels remained unchanged.
Significantly decreased Cd36 mRNA levels in sWAT.
Significantly increased lipid content in epididymal white adipose tissue (eWAT).
Significantly elevated ratio of M1 (CD11c-positive) to M2 (CD206-positive) macrophages in sWAT.
Molecular Weight

7876.83 (free acid)

Formula

C345H520N92O106S7.xC2HF3O2

Sequence

Thr-Glu-Pro-Leu-Phe-Leu-Thr-Lys-Thr-Asp-Ile-Cys-Lys-Leu-Ser-Arg-Asp-Ala-Gly-Thr-Cys-Val-Asp-Phe-Lys-Leu-Leu-Trp-His-Tyr-Asp-Leu-Glu-Ser-Lys-Ser-Cys-Lys-Arg-Phe-Trp-Tyr-Gly-Gly-Cys-Gly-Gly-Asn-Glu-Asn-Arg-Phe-His-Ser-Gln-Glu-Glu-Cys-Glu-Lys-Met-Cys-Ser-Pro-Glu-Leu-Thr-Val (Disulfide bridge:Cys12-Cys62,Cys21-Cys4,Cys37-Cys58)

Sequence Shortening

TEPLFLTKTDICKLSRDAGTCVDFKLLWHYDLESKSCKRFWYGGCGGNENRFHSQEECEKMCSPELTV (Disulfide bridge:Cys12-Cys62,Cys21-Cys4,Cys37-Cys58)

SMILES

O=C(N[C@@H](CCC(O)=O)C(N1[C@@H](CCC1)C(N[C@@H](CC(C)C)C(N[C@@H](CC2=CC=CC=C2)C(N[C@@H](CC(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](CCCCN)C(N[C@@H]([C@H](O)C)C(N[C@@H](CC(O)=O)C(N[C@@H]([C@@H](C)CC)C(N[C@@H](CSSC[C@@H](C(N[C@@H](CO)C(N3[C@@H](CCC3)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H]([C@H](O)C)C(N[C@@H](C(C)C)C(O)=O)=O)=O)=O)=O)=O)=O)NC4=O)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CO)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC(O)=O)C(N[C@@H](C)C(NCC(N[C@@H]([C@H](O)C)C(N[C@@H](CSSC[C@@H](C(NCC(NCC(N[C@@H](CC(N)=O)C(N[C@@H](CCC(O)=O)C(N[C@@H](CC(N)=O)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC5=CC=CC=C5)C(N[C@@H](CC6=CNC=N6)C(N[C@@H](CO)C(N[C@@H](CCC(N)=O)C(N[C@@H](CCC(O)=O)C(N[C@H]7CCC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)NC8=O)C(N[C@@H](C(C)C)C(N[C@@H](CC(O)=O)C(N[C@@H](CC9=CC=CC=C9)C(N[C@@H](CCCCN)C(N[C@@H](CC(C)C)C(N[C@@H](CC(C)C)C(N[C@@H](CC%10=CNC%11=CC=CC=C%10%11)C(N[C@@H](CC%12=CNC=N%12)C(N[C@@H](CC%13=CC=C(C=C%13)O)C(N[C@@H](CC(O)=O)C(N[C@@H](CC(C)C)C(N[C@@H](CCC(O)=O)C(N[C@@H](CO)C(N[C@@H](CCCCN)C(N[C@@H](CO)C(N[C@@H](CSSC[C@@H](C(N[C@@H](CCC(O)=O)C(N[C@@H](CCCCN)C(N[C@H]4CCSC)=O)=O)=O)NC7=O)C(N[C@@H](CCCCN)C(N[C@@H](CCCNC(N)=N)C(N[C@@H](CC%14=CC=CC=C%14)C(N[C@@H](CC%15=CNC%16=CC=CC=C%15%16)C(N[C@@H](CC%17=CC=C(C=C%17)O)C(NCC(NC8)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)[C@H]([C@H](O)C)N.OC(C(F)(F)F)=O.[x]

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation
References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Endotrophin (Mus musculus) TFA
Cat. No.:
HY-P5081A
Quantity:
MCE Japan Authorized Agent: