1. Peptides
  2. OVA (241-270) (TFA)

OVA (241-270) (TFA) 

Cat. No.: HY-P2495A
Handling Instructions

OVA (241-270) TFA, a non-specific cytotoxic T lymphocyte (CTL) peptide, is a fragmented peptide of OVA (ovalbumin) antigen.

For research use only. We do not sell to patients.

Custom Peptide Synthesis

OVA (241-270) (TFA) Chemical Structure

OVA (241-270) (TFA) Chemical Structure

Size Price Stock Quantity
5 mg USD 270 In-stock
Estimated Time of Arrival: December 31
10 mg USD 460 In-stock
Estimated Time of Arrival: December 31
50 mg   Get quote  
100 mg   Get quote  

* Please select Quantity before adding items.

Customer Review

Based on 1 publication(s) in Google Scholar

Other Forms of OVA (241-270) (TFA):

Top Publications Citing Use of Products
  • Biological Activity

  • Purity & Documentation

  • References

  • Customer Review

Description

OVA (241-270) TFA, a non-specific cytotoxic T lymphocyte (CTL) peptide, is a fragmented peptide of OVA (ovalbumin) antigen[1].

Molecular Weight

3535.92

Formula

C₁₅₆H₂₄₇F₃N₃₄O₅₃S₁

Sequence Shortening

SMLVLLPDEVSGLEQLESIINFEKLTEWTS

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Sealed storage, away from moisture

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture)

References
  • No file chosen (Maximum size is: 1024 Kb)
  • If you have published this work, please enter the PubMed ID.
  • Your name will appear on the site.
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Keywords:

OVA (241-270) (TFA)OthersInhibitorinhibitorinhibit

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
OVA (241-270) (TFA)
Cat. No.:
HY-P2495A
Quantity:
MCE Japan Authorized Agent: