country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10931F

Copy Link Print Information

RAD21 (356–395), biotin labeled

RAD21 (356–395), biotin labeled is biotin-labeled RAD21 (356–395) (HY-P10931). RAD21 (356–395) is a peptide encompassing amino acids 356 to 395 of the RAD21 protein, which can be used to study the interaction mechanism between STAG1 and RAD21. The equilibrium dissociation constant (K_D) value for the interaction between RAD21 (356–395) and STAG1 is 127 nM.

For research use only. We do not sell to patients.

Formula: C₂₄₁H₃₉₀N₆₀O₆₀S₄
Molecular Weight:5216.30

Storage:

Please store the product under the recommended conditions in the Certificate of Analysis.

RAD21 (356–395), biotin labeled Chemical Structure

Price

Stock

Quantity

Amount: USD 0.00

* Please select Quantity before adding items.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity

Description

Chemical Information

Molecular Weight 5216.30
Formula C₂₄₁H₃₉₀N₆₀O₆₀S₄
Sequence

{Biotin-Ttds}-Pro-Thr-Lys-Lys-Leu-Met-Met-Trp-Lys-Glu-Thr-Gly-Gly-Val-Glu-Lys-Leu-Phe-Ser-Leu-Pro-Ala-Gln-Pro-Leu-Trp-Asn-Asn-Arg-Leu-Leu-Lys-Leu-Phe-Thr-Arg-Cys-Leu-Thr-Pro
Sequence Shortening

{Biotin-Ttds}-PTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTP
Shipping

Room temperature in continental US; may vary elsewhere.
Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (259 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. van der Lelij P, et al. STAG1 vulnerabilities for exploiting cohesin synthetic lethality in STAG2-deficient cancers. Life Sci Alliance. 2020 May 28;3(7):e202000725. [Content Brief]

Calculators

Molarity Calculator

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Dilution Calculator

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Get Quote In-stock

Other size

Get Quote