country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10931A

Copy Link Print Information

RAD21 (356–395) TFA

RAD21 (356–395) TFA is a peptide encompassing amino acids 356 to 395 of the RAD21 protein, which can be used to study the interaction mechanism between STAG1 and RAD21. The equilibrium dissociation constant (K_D) value for the interaction between RAD21 (356–395) TFA and STAG1 is 127 nM.

Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.

Formule: C₂₁₇H₃₅₀N₅₆O₅₃S₃.xC₂HF₃O₂
Masse moléculaire:4687.64 (free base)

Stockage:

Please store the product under the recommended conditions in the Certificate of Analysis.

RAD21 (356–395) TFA Chemical Structure

Stock

Quantité

Amount: USD 0.00

* Veuillez sélectionner la quantité avant d'ajouter des articles.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Activité biologique
- Description
- IC₅₀ & Target
Chemical Information
Pureté et documentation
Références
Calculators
Help & FAQs
Classifications
Bioz

Activité biologique

Description

IC₅₀ & Target

KD: 127 nM (STAG1)^[1].

Chemical Information

Masse moléculaire 4687.64 (free base)
Formule C₂₁₇H₃₅₀N₅₆O₅₃S₃.xC₂HF₃O₂
Sequence

Pro-Thr-Lys-Lys-Leu-Met-Met-Trp-Lys-Glu-Thr-Gly-Gly-Val-Glu-Lys-Leu-Phe-Ser-Leu-Pro-Ala-Gln-Pro-Leu-Trp-Asn-Asn-Arg-Leu-Leu-Lys-Leu-Phe-Thr-Arg-Cys-Leu-Thr-Pro
Sequence Shortening

PTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTP
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Please store the product under the recommended conditions in the Certificate of Analysis.

Pureté et documentation

Select Batch:

Pureté: 99.98%

Assay: 99.98%

ee.: 99.98%

Fiche technique (297 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Instruction de manipulation (2659 KB)

Références

[1]. van der Lelij P, et al. STAG1 vulnerabilities for exploiting cohesin synthetic lethality in STAG2-deficient cancers. Life Sci Alliance. 2020 May 28;3(7):e202000725. [Content Brief]

Calculators

Calculateur de molarité

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

Calculateur de dilution

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

Obtenir un devis En stock

Other size

Obtenir un devis