country

Change Language

EN - English
FR - Français
DE - Deutsch
ES - Español
JA - 日本語
KO - 한국어

Country or Region:

United States

Product Name	Size / Unit Price	Qty

Total: USD 0.00 Checkout

Cat. No.: HY-P10931A

Copy Link Print Information

RAD21 (356–395) TFA

RAD21 (356–395) TFA is a peptide encompassing amino acids 356 to 395 of the RAD21 protein, which can be used to study the interaction mechanism between STAG1 and RAD21. The equilibrium dissociation constant (K_D) value for the interaction between RAD21 (356–395) TFA and STAG1 is 127 nM.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

화학식: C₂₁₇H₃₅₀N₅₆O₅₃S₃.xC₂HF₃O₂
분자량:4687.64 (free base)

보관:

Please store the product under the recommended conditions in the Certificate of Analysis.

RAD21 (356–395) TFA Chemical Structure

Amount: USD 0.00

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Use of MCE Products

Strong Fluorescence Signal / Multi-Disciplinary Applications / High Fluorescence Specificity

Biological Activity
- 제품 설명
- IC₅₀ & Target
Chemical Information
순도&문서
References
Calculators
Help & FAQs
Classifications
Bioz

Biological Activity

제품 설명

IC₅₀ & Target

KD: 127 nM (STAG1)^[1].

Chemical Information

분자량 4687.64 (free base)
화학식 C₂₁₇H₃₅₀N₅₆O₅₃S₃.xC₂HF₃O₂
Sequence

Pro-Thr-Lys-Lys-Leu-Met-Met-Trp-Lys-Glu-Thr-Gly-Gly-Val-Glu-Lys-Leu-Phe-Ser-Leu-Pro-Ala-Gln-Pro-Leu-Trp-Asn-Asn-Arg-Leu-Leu-Lys-Leu-Phe-Thr-Arg-Cys-Leu-Thr-Pro
Sequence Shortening

PTKKLMMWKETGGVEKLFSLPAQPLWNNRLLKLFTRCLTP
선적

Room temperature in continental US; may vary elsewhere.
보관

Please store the product under the recommended conditions in the Certificate of Analysis.

순도&문서

Select Batch:

Purity: 99.98%

Assay: 99.98%

ee.: 99.98%

Data Sheet (297 KB)
COA (2659 KB)
Elemental Analysis Report (2659 KB)
HNMR (2659 KB)
CNMR (2659 KB)
RP-HPLC (2659 KB)
NP-HPLC (2659 KB)
MS (2659 KB)
LCMS (2659 KB)
IR (2659 KB)
GC (2659 KB)
OR (2659 KB)
SDS-PAGE (2659 KB)
SEC-HPLC (2659 KB)
Other Report (2659 KB)
Handling Instructions (2659 KB)

References

[1]. van der Lelij P, et al. STAG1 vulnerabilities for exploiting cohesin synthetic lethality in STAG2-deficient cancers. Life Sci Alliance. 2020 May 28;3(7):e202000725. [Content Brief]

Calculators

몰농도 계산기

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass Mass

Concentration Concentration

Volume Volume

Molecular Weight Molecular Weight

농도 희석 계산기

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

Concentration _(start) Concentration _(start)

Volume _(start) Volume _(start)

Concentration _(final) Concentration _(final)

Volume _(final) Volume _(final)

Help & FAQs

How should lyophilized recombinant proteins be reconstituted and stored?

1. Before opening the cap, centrifuge the vial at 13000 rpm for 20-30 seconds. This step will ensure that any lyophilized powder that may have adhered to the cap or walls is collected at the bottom of the vial, minimizing the risk of product loss.

Bioz

Keywords

MOQ

Minimum order quantity

100 mg

견적 받기 해외재고보유

Other size

견적 받기