14-3-3 beta Protein, Human (His)

Customer Review

Based on 1 Customer Validation

14-3-3 beta proteins serve as adapter proteins that regulate multiple signaling pathways by recognizing phosphoserine or phosphothreonine motifs and regulating chaperone activity. It acts as a negative regulator during osteogenesis, inhibiting nuclear translocation of SRPK2 and preventing neuronal apoptosis. 14-3-3 beta Protein, Human (His) is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

14-3-3 beta proteins serve as adapter proteins that regulate multiple signaling pathways by recognizing phosphoserine or phosphothreonine motifs and regulating chaperone activity. It acts as a negative regulator during osteogenesis, inhibiting nuclear translocation of SRPK2 and preventing neuronal apoptosis. 14-3-3 beta Protein, Human (His) is the recombinant human-derived 14-3-3 beta protein, expressed by E. coli , with N-6*His labeled tag.

Background

The 14-3-3 beta protein serves as an adapter implicated in the regulation of a wide spectrum of both general and specialized signaling pathways. Recognizing phosphoserine or phosphothreonine motifs, it binds to numerous partners, modulating the activity of the binding partner upon interaction. It acts as a negative regulator of osteogenesis by blocking the nuclear translocation of the phosphorylated form of SRPK2, counteracting its stimulatory effect on cyclin D1 expression, and thereby preventing neuronal apoptosis induced by SRPK2. Additionally, 14-3-3 beta negatively regulates signaling cascades that activate MAP kinases through AKAP13. Existing as a homodimer, it interacts with various proteins, including SAMSN1, PRKCE, AKAP13, SSH1, TORC2/CRTC2, ABL1, ROR2, GAB2, YAP1, SRPK2, PKA-phosphorylated AANAT, MYO1C, SIRT2, DAPK2, PI4KB, TBC1D22A, TBC1D22B, SOS1, YWHAB, SLITRK1, SYNPO2, RIPOR2, MARK2, MARK3, TESK1, MEFV, HDAC4, and ADAM22. These interactions highlight the diverse roles of 14-3-3 beta in various cellular processes and signaling pathways.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • 14-3-3β (M1-N246)
      Accession # P31946
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    YWHAB; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein Beta; YWHAA; 14-3-3 Protein Beta/Alpha; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenase Activation Protein; Alpha Polypeptide; Tyrosine 3-Monooxygenase/Tryptophan 5-Monooxygenas

  • AA Sequence

    MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN

  • Predicted Molecular Mass

    28.1 kDa

  • Molecular Weight

    Approximately 29 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCl, 300 mM NaCl, pH 7.4.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00