ACK1 Protein, Human (Active, sf9, GST)

Customer Review

Based on 1 Customer Validation

The ACK1 protein is a non-receptor tyrosine protein and serine/threonine protein kinase that orchestrates cellular physiology by affecting cell spreading, migration, survival, growth, and proliferation. It phosphorylates AKT1, AR, MCF2, WASL and WWOX, affecting various cellular processes. ACK1 Protein, Human (sf9, GST) is the recombinant human-derived ACK1 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The ACK1 protein is a non-receptor tyrosine protein and serine/threonine protein kinase that orchestrates cellular physiology by affecting cell spreading, migration, survival, growth, and proliferation. It phosphorylates AKT1, AR, MCF2, WASL and WWOX, affecting various cellular processes. ACK1 Protein, Human (sf9, GST) is the recombinant human-derived ACK1 protein, expressed by Sf9 insect cells , with N-GST labeled tag.

Background

ACK1 Protein, a non-receptor tyrosine-protein and serine/threonine-protein kinase, plays a multifaceted role in cell physiology, influencing cell spreading, migration, survival, growth, and proliferation by transducing extracellular signals to cytosolic and nuclear effectors. It phosphorylates AKT1, AR, MCF2, WASL, and WWOX, impacting various cellular processes. Involved in trafficking and clathrin-mediated endocytosis, ACK1 binds to epidermal growth factor receptor (EGFR) and clathrin, regulating ligand-induced EGFR degradation and contributing to EGFR accumulation at early endosomes' limiting membrane. As a downstream effector of CDC42, ACK1 mediates CDC42-dependent cell migration through BCAR1 phosphorylation. In brain development and adult synaptic function, ACK1 may play a role. Activating AKT1 by phosphorylating it on 'Tyr-176,' ACK1 also phosphorylates AR on 'Tyr-267' and 'Tyr-363,' promoting its recruitment to androgen-responsive enhancers (AREs). Additionally, ACK1 phosphorylates WWOX on 'Tyr-287' and MCF2, enhancing its guanine nucleotide exchange factor (GEF) activity towards Rho family proteins. Furthermore, ACK1 contributes to the control of AXL receptor levels. In cancer, ACK1 confers metastatic properties and promotes tumor growth by negatively regulating tumor suppressors such as WWOX and positively regulating pro-survival factors including AKT1 and AR, showcasing its intricate involvement in oncogenic processes. Additionally, ACK1 phosphorylates WASP, further underscoring its diverse signaling capabilities.

Verified Bioactivity

The specific activity was determined to be ≥ 4 nmol/min/mg using synthetic Abl peptide (EAIYAAPFAKKK) as substrate.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 85%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • ACK1 (G110-W476)
      Accession # Q07912-1
    • C-term
  • Protein Length

    Partial

  • Synonyms

    TNK2; ACK; Tyrosine Kinase Non Receptor 2; Activated Cdc42-Associated Kinase 1; ACK1; ACK-1; Tyrosine Kinase Non-Receptor Protein 2; Non-Specific Protein-Tyrosine Kinase; Activated CDC42 Kinase 1; Tyrosine Kinase, Non-Receptor, 2; P21cdc42Hs; Activated P2

  • AA Sequence

    GEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCW

  • Predicted Molecular Mass

    68 kDa

  • Molecular Weight

    Approximately 62 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 85%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol, 0.5 mM EDTA, 0.5 mM PMSF, 0.5 mM TCEP.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00