ACK1 Protein, Human (Active, sf9, GST)
Based on 1 Customer Validation
The ACK1 protein is a non-receptor tyrosine protein and serine/threonine protein kinase that orchestrates cellular physiology by affecting cell spreading, migration, survival, growth, and proliferation. It phosphorylates AKT1, AR, MCF2, WASL and WWOX, affecting various cellular processes. ACK1 Protein, Human (sf9, GST) is the recombinant human-derived ACK1 protein, expressed by Sf9 insect cells , with N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The ACK1 protein is a non-receptor tyrosine protein and serine/threonine protein kinase that orchestrates cellular physiology by affecting cell spreading, migration, survival, growth, and proliferation. It phosphorylates AKT1, AR, MCF2, WASL and WWOX, affecting various cellular processes. ACK1 Protein, Human (sf9, GST) is the recombinant human-derived ACK1 protein, expressed by Sf9 insect cells , with N-GST labeled tag.
Background
ACK1 Protein, a non-receptor tyrosine-protein and serine/threonine-protein kinase, plays a multifaceted role in cell physiology, influencing cell spreading, migration, survival, growth, and proliferation by transducing extracellular signals to cytosolic and nuclear effectors. It phosphorylates AKT1, AR, MCF2, WASL, and WWOX, impacting various cellular processes. Involved in trafficking and clathrin-mediated endocytosis, ACK1 binds to epidermal growth factor receptor (EGFR) and clathrin, regulating ligand-induced EGFR degradation and contributing to EGFR accumulation at early endosomes' limiting membrane. As a downstream effector of CDC42, ACK1 mediates CDC42-dependent cell migration through BCAR1 phosphorylation. In brain development and adult synaptic function, ACK1 may play a role. Activating AKT1 by phosphorylating it on 'Tyr-176,' ACK1 also phosphorylates AR on 'Tyr-267' and 'Tyr-363,' promoting its recruitment to androgen-responsive enhancers (AREs). Additionally, ACK1 phosphorylates WWOX on 'Tyr-287' and MCF2, enhancing its guanine nucleotide exchange factor (GEF) activity towards Rho family proteins. Furthermore, ACK1 contributes to the control of AXL receptor levels. In cancer, ACK1 confers metastatic properties and promotes tumor growth by negatively regulating tumor suppressors such as WWOX and positively regulating pro-survival factors including AKT1 and AR, showcasing its intricate involvement in oncogenic processes. Additionally, ACK1 phosphorylates WASP, further underscoring its diverse signaling capabilities.
Verified Bioactivity
The specific activity was determined to be ≥ 4 nmol/min/mg using synthetic Abl peptide (EAIYAAPFAKKK) as substrate.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-GST
-
Accession
Q07912-1 (G110-W476)
-
Molecular Construction
-
N-term
-
GST
-
ACK1 (G110-W476)
Accession # Q07912-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
TNK2; ACK; Tyrosine Kinase Non Receptor 2; Activated Cdc42-Associated Kinase 1; ACK1; ACK-1; Tyrosine Kinase Non-Receptor Protein 2; Non-Specific Protein-Tyrosine Kinase; Activated CDC42 Kinase 1; Tyrosine Kinase, Non-Receptor, 2; P21cdc42Hs; Activated P2
-
AA Sequence
GEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCW
-
Predicted Molecular Mass
68 kDa
-
Molecular Weight
Approximately 62 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol, 0.5 mM EDTA, 0.5 mM PMSF, 0.5 mM TCEP.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)