B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Beta-2 microglobulin (B2M) is vital in presenting antigens to the immune system through MHC class I molecules. It forms a heterodimer with an alpha chain to create MHC class I molecules. B2M also forms a heterotrimer with MR1 and a metabolite antigen, enhancing antigen presentation and immune recognition. B2M's molecular interactions facilitate immune system functioning and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His) is the recombinant mouse-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Beta-2 microglobulin (B2M) is vital in presenting antigens to the immune system through MHC class I molecules. It forms a heterodimer with an alpha chain to create MHC class I molecules. B2M also forms a heterotrimer with MR1 and a metabolite antigen, enhancing antigen presentation and immune recognition. B2M's molecular interactions facilitate immune system functioning and foreign substance recognition. B2M/Beta-2 microglobulin Protein, Mouse (HEK293, His) is the recombinant mouse-derived B2M/Beta-2 microglobulin protein, expressed by HEK293 , with C-His labeled tag.
Background
Beta-2 microglobulin (B2M) protein is a crucial component of the class I major histocompatibility complex (MHC), playing a key role in presenting peptide antigens to the immune system. It forms a heterodimer with an alpha chain, together comprising the major histocompatibility complex class I molecules. Additionally, B2M can form a heterotrimer with MR1 and a metabolite antigen, further contributing to antigen presentation and immune recognition processes. By participating in these molecular interactions, B2M helps in the proper functioning of the immune system and the recognition of foreign substances.
Verified Bioactivity
Immobilized Mouse B2M at 2 μg/mL (100 μL/well) can bind Anti-B2M antibody. The ED50 for this effect is 0.6243 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-His
-
Accession
P01887 (I21-M119, A105D)
-
Molecular Construction
-
N-term
-
B2M (I21-M119, A105D)
Accession # P01887 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
B2M; Beta 2-Microglobulin; Beta-2-Microglobulin; Beta-2-Microglobin; Beta Chain Of MHC Class I Molecules; AMYLD6; Beta 2-Microglobulin Protein; MHC1D4; Human Nkt Tcr Alpha Chain; IMD43; Human Nkt Tcr Beta Chain
-
AA Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
