Copy Link Print Information

B7-H4 Protein, Human (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (HEK293, His) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for B7-H4 Protein, Human (HEK293, His)
  • Experimental Validation Results for B7-H4 Protein, Human (HEK293, His)
  • B7-H4 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (HEK293, His) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

Background

B7-H4 protein functions as a negative regulator of the T-cell-mediated immune response, exerting inhibitory effects on T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Particularly significant when expressed on the cell surface of tumor macrophages, B7-H4, in collaboration with regulatory T-cells (Treg), plays a crucial role in suppressing tumor-associated antigen-specific T-cell immunity. Additionally, B7-H4 is implicated in the promotion of epithelial cell transformation, indicating its multifaceted involvement in modulating immune responses and cellular processes associated with tumor development.

Verified Bioactivity

1.Immobilized Recombinant Human B7-H4 / B7S1 / B7x Protein (His Tag) at 2 μg/mL (100 μL/well) can bind B7-H4 / B7S1 / B7x, Rabbit Pab , the EC50 is 1.5-4 ng/mL.
2.Loaded Felmetatug (HY-P990996) on AHC2 biosensor, can bind B7-H4 Protein, Human (HEK293, His) with an affinity constant of 3.886E-09 M as determined in BLI assay.
3.Loaded Mocertatug (HY-P991703) on ProA biosensor, can bind B7-H4 Protein, Human (HEK293, His, ) with an affinity constant of 1.401E-07 M as determined in BLI assay.

MCE Validation Data

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Mocertatug (HY-P991703) on ProA biosensor, can bind B7-H4 Protein, Human (HEK293, His, ) with an affinity constant of 1.401E-07 M as determined in BLI assay.

  • Bioactivity - BLI

    Bioactivity - BLI

    Loaded Felmetatug (HY-P990996) on AHC2 biosensor, can bind B7-H4 Protein, Human (HEK293, His) with an affinity constant of 3.886E-09 M as determined in BLI assay.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q7Z7D3-1 (F29-A258)

  • Gene ID
    79679  [NCBI]
  • Molecular Construction
    • N-term
    • B7-H4 (F29-A258)
      Accession # Q7Z7D3-1
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    VTCN1; V-Set Domain Containing T Cell Activation Inhibitor 1; B7-H4; B7H4; B7h.5; B7S1; B7x; V-Set Domain-Containing T-Cell Activation Inhibitor 1; Immune Costimulatory Protein B7-H4; B7 Superfamily Member 1; B7 Family Member, H4; B7 Homolog 4; FLJ22418;

  • AA Sequence

    FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA

  • Predicted Molecular Mass

    26.8 kDa

  • Molecular Weight

    Approximately 39-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     Loaded Mocertatug (HY-P991703) on ProA biosensor, can bind B7-H4 Protein, Human (HEK293, His, ) with an affinity constant of 1.401E-07 M as determined in BLI assay.

  • 1/16

    MedChemExpress Validation
     Loaded Felmetatug (HY-P990996) on AHC2 biosensor, can bind B7-H4 Protein, Human (HEK293, His) with an affinity constant of 3.886E-09 M as determined in BLI assay.

  • B7-H4 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for B7-H4 Protein, Human (HEK293, His)
  • Experimental Validation Results for B7-H4 Protein, Human (HEK293, His)
  • B7-H4 Protein, Human (HEK293, His) Product Image