B7-H4 Protein, Human (HEK293, His)

The B7-H4 protein acts as a negative regulator, inhibiting T cell-mediated immune responses, including activation, proliferation, cytokine production, and cytotoxicity. When expressed on tumor macrophages, it cooperates with regulatory T cells to suppress tumor-associated antigen-specific T cell immunity. B7-H4 Protein, Human (HEK293, His) is the recombinant human-derived B7-H4 protein, expressed by HEK293 , with C-His labeled tag.

B7-H4 protein functions as a negative regulator of the T-cell-mediated immune response, exerting inhibitory effects on T-cell activation, proliferation, cytokine production, and the development of cytotoxicity. Particularly significant when expressed on the cell surface of tumor macrophages, B7-H4, in collaboration with regulatory T-cells (Treg), plays a crucial role in suppressing tumor-associated antigen-specific T-cell immunity. Additionally, B7-H4 is implicated in the promotion of epithelial cell transformation, indicating its multifaceted involvement in modulating immune responses and cellular processes associated with tumor development.

1.Immobilized Recombinant Human B7-H4 / B7S1 / B7x Protein (His Tag) at 2 μg/mL (100 μL/well) can bind B7-H4 / B7S1 / B7x, Rabbit Pab , the EC50 is 1.5-4 ng/mL.
2.Loaded Felmetatug (HY-P990996) on AHC2 biosensor, can bind B7-H4 Protein, Human (HEK293, His) with an affinity constant of 3.886E-09 M as determined in BLI assay.
3.Loaded Mocertatug (HY-P991703) on ProA biosensor, can bind B7-H4 Protein, Human (HEK293, His, ) with an affinity constant of 1.401E-07 M as determined in BLI assay.

• 
  Loaded Mocertatug (HY-P991703) on ProA biosensor, can bind B7-H4 Protein, Human (HEK293, His, ) with an affinity constant of 1.401E-07 M as determined in BLI assay.
• 
  Loaded Felmetatug (HY-P990996) on AHC2 biosensor, can bind B7-H4 Protein, Human (HEK293, His) with an affinity constant of 3.886E-09 M as determined in BLI assay.

Human

HEK293

C-His

Q7Z7D3-1 (F29-A258)

79679  [NCBI]

Extracellular Domain

FGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA

Approximately 39-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% Tween 80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.