Basigin/CD147 Protein, Mouse (HEK293, His)

Customer Review

Based on 1 Customer Validation

The Basigin/CD147 protein is essential for retinal maturation and development, acting as a NXNL1 receptor to promote the survival of retinal cone photoreceptor cells. Basigin/CD147 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The Basigin/CD147 protein is essential for retinal maturation and development, acting as a NXNL1 receptor to promote the survival of retinal cone photoreceptor cells. Basigin/CD147 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Basigin/CD147 protein, expressed by HEK293 , with C-His labeled tag.

Background

Basigin/CD147 protein is indispensable for normal retinal maturation and development, acting as a crucial cell surface receptor for NXNL1 and contributing significantly to NXNL1-mediated survival of retinal cone photoreceptors. In collaboration with the glucose transporter SLC16A1/GLUT1 and NXNL1, Basigin/CD147 promotes retinal cone survival by enhancing aerobic glycolysis and facilitating the entry of glucose into photoreceptors. It serves as a signaling receptor for cyclophilins, playing an essential role in PPIA/CYPA and PPIB/CYPB-dependent signaling related to the chemotaxis and adhesion of immune cells. Additionally, Basigin/CD147 is pivotal in targeting the monocarboxylate transporters SLC16A1, SLC16A3, and SLC16A8 to the plasma membrane. Acting as a coreceptor for vascular endothelial growth factor receptor 2 (KDR/VEGFR2) in endothelial cells, it enhances VEGFA-mediated activation and downstream signaling, promoting angiogenesis through EPAS1/HIF2A-mediated up-regulation of VEGFA and KDR/VEGFR2. Moreover, Basigin/CD147 plays a crucial role in spermatogenesis, mediating interactions between germ cells and Sertoli cells and proving essential for the development and differentiation of germ cells into round spermatids.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized SARS-COV-2 S RBD (HY-P7431) at 1 μg/mL (100 μL/well) on the plate can bind biotinylated Mouse CD147. The ED50 for this effect is 7.713 μg/mL.

MCE Validation Data

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized SARS-COV-2 S RBD (HY-P7431) at 1 μg/mL (100 μL/well) on the plate can bind biotinylated Mouse CD147. The ED50 for this effect is 7.713 μg/mL.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • Basigin (A22-R209)
      Accession # P18572-2/NP_001070652.1
    • His
    • C-term
  • Protein Length

    Partial Extracellular Domain

  • Synonyms

    BSG; Leukocyte Activation Antigen M6; Prev. OK; Hepatoma-Associated Antigen; EMMPRIN; OK Blood Group Antigen; Basigin; HAb18G; Tumor Cell-Derived Collagenase Stimulatory Factor; TCSF; Extracellular Matrix Metalloproteinase Inducer; 5F7; EMPRIN; Ok Blood G

  • AA Sequence

    AAGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSR

  • Predicted Molecular Mass

    30 kDa

  • Molecular Weight

    Approximately 30-35 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00