BMP-3B/GDF10 Protein, Human (His)
Based on 2 publication(s) in Google Scholar
Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways. BMP-3B/GDF10 Protein, Human has a total length of 110 amino acids (Q369-R478), is expressed in E. coli cells.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- References
- Help & FAQs
Biological Activity
Bone morphogenetic protein 3 (BMP-3; GDF10) is a polymorphic ligand protein belonging to the TGF-β family. BMP-3 is the main component of osteoblast and has osteogenic activity[1]. BMP-3 plays an inhibitory role in the carcinogenic process, and inhibits the occurrence of colon tumors through ActRIIB/ SMad2-dependent and TAK1/JNK signaling pathways[2]. BMP-3B/GDF10 Protein, Human has a total length of 110 amino acids (Q369-R478), is expressed in E. coli cells.
Bone Morphogenetic Protein 3 (BMP-3) is a ligand protein with pleiotropic, belongs to TGFβ family. BMP-3 is a major component of osteogenin, which has osteogenic activity[1].
BMP-3 is widely found in different animals, while the sequence in human is lowly similar to Rat (81.94%), and mouse (80.86%).
BMP-3 particularly serves as a reliable biomarker for screening colorectal cancer (CRC) because BMP-3 is hypermethylated and its protein expression is significantly reduced in cancer cell lines[2].
BMP-3 also plays a suppressor role in carcinogenesis, suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways[2].
BMP-3 could exert two-way regulatory effects on activin signaling in distinct cell types. BMP-3 stimulates proliferation of human mesenchymal stem cells which could be blocked by TGF-β/activin receptor kinase inhibitors[3].
BMP/TGFβ signaling to involve in vascular and valvular homeostasis, which is a critical process of embryonic development[4]. And BMP/TGFβ signaling can be terminated by inhibitory SMADs including SMAD6 and SMAD7, which are activated and induced by BMP signaling and switch off BMP signaling via multiple mechanisms[5].
BMP-3 (1, 10, 50, and 10 ng/mL; 7, 14, and 21 d) alone and in combination with 10 ng/mL TGF-β promotes differentiation of human mesenchymal stem cells to a nucleus poposus phenotype[6].
BMP-3 (1, 2.5, and 10 ng/mL; 3 d) inhibits human bone marrow stromal cell (HBMSC) growth in a dose-dependent manner[7].
Publications (2)
-
Journal Impact Factor
-
Most Recent
-
Cell Stem Cell
Human PSC-derived sinoatrial node-cardiac plexus assembloids model innervation-associated maturation of pacemaker systems. [Abstract]2026 May 15:S1934-5909(26)00158-X. PMID: 42143017 -
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His
-
Accession
P55107 (Q369-R478)
-
Molecular Construction
-
N-term
-
10*His
-
BMP-3B (Q369-R478)
Accession # P55107 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GDF10; Bone-Inducing Protein; Growth Differentiation Factor 10; BMP3B; BMP-3b; BIP; Growth/Differentiation Factor 10; BMP-3B; Bone Morphogenetic Protein 3B; GDF-10
-
AA Sequence
QWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYCAGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVLFLDENRNVVLKVYPNMSVDTCACR
-
Predicted Molecular Mass
16.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (264 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
[1]. Yang P, et al. The role of bone morphogenetic protein signaling in vascular calcification. Bone. 2020 Dec;141:115542. [Content Brief]
[2]. Miyazawa K, et al. Regulation of TGF-β Family Signaling by Inhibitory Smads. Cold Spring Harb Perspect Biol. 2017 Mar 1;9(3):a022095. [Content Brief]
[3]. Wen J, et al. BMP3 suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways. J Exp Clin Cancer Res. 2019 Oct 28;38(1):428. [Content Brief]
[4]. Bahamonde ME, et al. BMP3: to be or not to be a BMP. J Bone Joint Surg Am. 2001;83-A Suppl 1(Pt 1):S56-62. [Content Brief]
[5]. Stewart A, et al. BMP-3 promotes mesenchymal stem cell proliferation through the TGF-beta/activin signaling pathway. J Cell Physiol. 2010 Jun;223(3):658-66. [Content Brief]
[6]. Zhou X, et al. BMP3 Alone and Together with TGF-β Promote the Differentiation of Human Mesenchymal Stem Cells into a Nucleus Pulposus-Like Phenotype. Int J Mol Sci. 2015 Aug 27;16(9):20344-59. [Content Brief]
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
