1. Recombinant Proteins
  2. Others
  3. Brorin/VWC2 Protein, Human (HEK293, His)

The Brorin/VWC2 protein is a bone morphogenetic protein antagonist that promotes cell adhesion and associates peripherally with the AMPAR complex, a key player in synaptic transmission. In the AMPAR complex, Brorin/VWC2 and various proteins (such as CNIH2, CNIH3, CACNG2, etc.) together form a complex structure. Brorin/VWC2 Protein, Human (HEK293, His) is the recombinant human-derived Brorin/VWC2 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

The Brorin/VWC2 protein is a bone morphogenetic protein antagonist that promotes cell adhesion and associates peripherally with the AMPAR complex, a key player in synaptic transmission. In the AMPAR complex, Brorin/VWC2 and various proteins (such as CNIH2, CNIH3, CACNG2, etc.) together form a complex structure. Brorin/VWC2 Protein, Human (HEK293, His) is the recombinant human-derived Brorin/VWC2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Brorin/VWC2 Protein, a bone morphogenetic protein (BMP) antagonist, is implicated in neural development and functions as a promoter of cell adhesion. It is peripherally associated with the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) complex, a critical player in synaptic transmission. The AMPAR complex consists of an inner core comprising pore-forming GluA/GRIA proteins and major auxiliary subunits arranged in a twofold symmetry. Brorin/VWC2, serving as one of the peripherally associated constituents, contributes to the intricate architecture of the AMPAR complex. This complex includes various proteins like CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG8, GSG1L, PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L, and NRN1, among others. Together, these proteins form a platform that regulates the gating, pharmacology, biogenesis, and protein processing of the AMPAR complex, thereby influencing synaptic function and plasticity.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Human Brorin/VWC2 is coated at 10 µg/mL can bind Biotinylated Human BMP-6 (HY-P700029AF). The ED50 for this effect is 4.2 µg/mL.

  • Measured by its binding ability in a functional ELISA. When Recombinant Human Brorin/VWC2 is coated at 10 µg/mL can bind Biotinylated Human BMP-6 (HY-P700029AF). The ED50 for this effect is 4.2 µg/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q2TAL6 (S28-M325)

Gene ID
Molecular Construction
N-term
Brorin (S28-M325)
Accession # Q2TAL6
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Brorin; Brain-specific chordin-like protein; UNQ739/PRO1434
AA Sequence

SPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM

Predicted Molecular Mass
32.6 kDa
분자량

Approximately 44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

Glycosylation
Yes
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

Brorin/VWC2 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

Brorin/VWC2 Protein, Human (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
Brorin/VWC2 Protein, Human (HEK293, His)
Cat. No.:
HY-P77506
수량:
MCE Japan Authorized Agent: