Copy Link Print Information

Brorin/VWC2 Protein, Human (HEK293, His)

Customer Review

Based on 1 Customer Validation

The Brorin/VWC2 protein is a bone morphogenetic protein antagonist that promotes cell adhesion and associates peripherally with the AMPAR complex, a key player in synaptic transmission. In the AMPAR complex, Brorin/VWC2 and various proteins (such as CNIH2, CNIH3, CACNG2, etc.) together form a complex structure. Brorin/VWC2 Protein, Human (HEK293, His) is the recombinant human-derived Brorin/VWC2 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for Brorin/VWC2 Protein, Human (HEK293, His)
  • Experimental Validation Results for Brorin/VWC2 Protein, Human (HEK293, His)
  • Brorin/VWC2 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The Brorin/VWC2 protein is a bone morphogenetic protein antagonist that promotes cell adhesion and associates peripherally with the AMPAR complex, a key player in synaptic transmission. In the AMPAR complex, Brorin/VWC2 and various proteins (such as CNIH2, CNIH3, CACNG2, etc.) together form a complex structure. Brorin/VWC2 Protein, Human (HEK293, His) is the recombinant human-derived Brorin/VWC2 protein, expressed by HEK293 , with C-His labeled tag.

Background

Brorin/VWC2 Protein, a bone morphogenetic protein (BMP) antagonist, is implicated in neural development and functions as a promoter of cell adhesion. It is peripherally associated with the α-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor (AMPAR) complex, a critical player in synaptic transmission. The AMPAR complex consists of an inner core comprising pore-forming GluA/GRIA proteins and major auxiliary subunits arranged in a twofold symmetry. Brorin/VWC2, serving as one of the peripherally associated constituents, contributes to the intricate architecture of the AMPAR complex. This complex includes various proteins like CNIH2, CNIH3, CACNG2, CACNG3, CACNG4, CACNG8, GSG1L, PRRT1, PRRT2, CKAMP44/SHISA9, FRRS1L, and NRN1, among others. Together, these proteins form a platform that regulates the gating, pharmacology, biogenesis, and protein processing of the AMPAR complex, thereby influencing synaptic function and plasticity.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. When Recombinant Human Brorin/VWC2 is coated at 10 µg/mL can bind Biotinylated Human BMP-6 (HY-P700029AF). The ED50 for this effect is 4.2 µg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. When Recombinant Human Brorin/VWC2 is coated at 10 µg/mL can bind Biotinylated Human BMP-6 (HY-P700029AF). The ED50 for this effect is 4.2 µg/mL.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession

    Q2TAL6 (S28-M325)

  • Gene ID
    375567  [NCBI]
  • Molecular Construction
    • N-term
    • Brorin (S28-M325)
      Accession # Q2TAL6
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    VWC2; Von Willebrand Factor C Domain Containing 2; PSST739; UNQ739; Brorin; Von Willebrand Factor C Domain-Containing Protein 2; Brain-Specific Chordin-Like Protein; Brain-Specific Chordin-Like

  • AA Sequence

    SPSIPLEKLAQAPEQPGQEKREHASRDGPGRVNELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQGGGAKAGDLQVRPRGDTPQAEALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLCTEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCRCEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTICHCTYEEGTWRIERQAMCTRHECRQM

  • Predicted Molecular Mass

    32.6 kDa

  • Molecular Weight

    Approximately 44 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. When Recombinant Human Brorin/VWC2 is coated at 10 µg/mL can bind Biotinylated Human BMP-6 (HY-P700029AF). The ED50 for this effect is 4.2 µg/mL.

  • Brorin/VWC2 Protein, Human (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for Brorin/VWC2 Protein, Human (HEK293, His)
  • Experimental Validation Results for Brorin/VWC2 Protein, Human (HEK293, His)
  • Brorin/VWC2 Protein, Human (HEK293, His) Product Image