1. Recombinant Proteins
  2. Calcitonin Protein, Human (His)

Calcitonin Protein, Human (His)

Cat. No.: HY-P7708
Handling Instructions

Calcitonin Protein, Human (His), is a recombinant human Calcitonin expressed in E. coli with a His tag at the N-terminus. Calcitonin has an effect on decreasing osteoclast activity and has the potential for hypercalcemia research[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $115 Ask For Quote & Lead Time
50 μg $345 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuCalcitonin, His; Calcitonin; Katacalcin; Calcitonin Carboxyl-Terminal Peptide; CCP; PDN-21; CALCA; CALC1
Species

Human

Source

E. coli

Accession

P01258 (Y58-N141)

Gene ID

796

Molecular Weight

Approximately 16.0 kDa

AA Sequence

YVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNANHHHHHH

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filter solution of 20 mM PB, 150 mM NaCl, 50% Glycerol, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C. It is stable at -20℃ for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Background

Calcitonin is a 32 amino acid hormone secreted by the C-cells of the thyroid gland. Calcitonin secretion is stimulated by increases in the serum calcium concentration and calcitonin protects against the development of hypercalcemia. Calcitonin is also stimulated by gastrointestinal hormones such as gastrin[1].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Calcitonin Protein, Human (His)
Cat. No.:
HY-P7708
Quantity:
MCE Japan Authorized Agent: