Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His)
Based on 1 Customer Validation
Carboxypeptidase B2/CPB2 protein cleaves C-terminal arginine or lysine residues from active peptides, regulating their activities. It also down-regulates fibrinolysis by removing C-terminal lysine residues from degraded fibrin. CPB2 contributes to peptide signaling and fibrinolysis regulation. Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Carboxypeptidase B2/CPB2 protein cleaves C-terminal arginine or lysine residues from active peptides, regulating their activities. It also down-regulates fibrinolysis by removing C-terminal lysine residues from degraded fibrin. CPB2 contributes to peptide signaling and fibrinolysis regulation. Carboxypeptidase B2/CPB2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.
Background
Carboxypeptidase B2/CPB2 protein functions by cleaving C-terminal arginine or lysine residues from biologically active peptides, such as kinins or anaphylatoxins, in the circulation, thereby regulating their activities. It also plays a role in down-regulating fibrinolysis by removing C-terminal lysine residues from partially degraded fibrin, which has been acted upon by plasmin. This protein thus contributes to the fine-tuning of peptide signaling and the regulation of fibrinolysis processes.
Verified Bioactivity
Specific activity is determined by a kinetic assay using Hippuryl-L-Arginine as substrate. One unit equals one micromole of Hippuryl-L-Arginine hyrolyzed per minute. Specific activity is reported in Units per milligram. The specific activity is 2.0-8.0 U/mg. (Activation description: The proenzyme needs to be activated by the mixture of Thrombin (HY-114164) and Human Thrombomodulin (HY-P70724) for an activated form.)
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-10*His
-
Accession
Q9JHH6 (F22-T422)
-
Molecular Construction
-
N-term
-
Cpb2 (M1-T422)
Accession # Q9JHH6 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CPB2; Carboxypeptidase B2 (Plasma, Carboxypeptidase U); Carboxypeptidase B2; Thrombin-Activatable Fibrinolysis Inhibitor; PCPB; Carboxypeptidase B2 (Plasma); TAFI; Plasma Carboxypeptidase B; CPU; Carboxypeptidase R; Thrombin-Activable Fibrinolysis Inhibitor; Carboxypeptidase B-Like Protein; Carboxypeptidase U
-
AA Sequence
FQSGQVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVDSVKAHLNVSRIPFNVLMNNVEDLIEQQTFNDTVSPRASASYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSFEKYPLYVLKVSGKEQRIKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENLYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSAHKNNRCVGTDLNRNFASKHWCEKGASSSSCSETYCGLYPESEPEVKAVADFLRRNIDHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERYIKPTCAEALAAISKIVWHVIRNT
-
Molecular Weight
Approximately 60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
