Carboxypeptidase B2/CPB2 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
Carboxypeptidase B2 (CPB2) protein acts as an enzyme that cleaves C-terminal arginine or lysine residues from biologically active peptides, including kinins or anaphylatoxins circulating in the blood, thereby regulating their activity. Furthermore, CPB2 plays a key role in downregulating fibrinolysis by removing C-terminal lysine residues from fibrin that has been partially degraded by plasmin. Carboxypeptidase B2/CPB2 Protein, Rat (HEK293, His) is the recombinant rat-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Carboxypeptidase B2 (CPB2) protein acts as an enzyme that cleaves C-terminal arginine or lysine residues from biologically active peptides, including kinins or anaphylatoxins circulating in the blood, thereby regulating their activity. Furthermore, CPB2 plays a key role in downregulating fibrinolysis by removing C-terminal lysine residues from fibrin that has been partially degraded by plasmin. Carboxypeptidase B2/CPB2 Protein, Rat (HEK293, His) is the recombinant rat-derived Carboxypeptidase B2/CPB2 protein, expressed by HEK293 , with C-His labeled tag.
Background
CaCarboxypeptidase B2 (CPB2) plays a critical role in physiological regulation, particularly within the circulatory system. The enzyme exhibits specificity in cleaving C-terminal arginine or lysine residues from biologically active peptides, including kinins and anaphylatoxins, thereby finely tuning their activities and downstream signaling in the circulation. Additionally, CPB2 is instrumental in the down-regulation of fibrinolysis by selectively removing C-terminal lysine residues from fibrin that has undergone partial degradation by plasmin. This dual functionality underscores CPB2's pivotal role in maintaining the balance of peptide activities and coagulation processes, emphasizing its significance in orchestrating intricate regulatory mechanisms within the physiological context.
Verified Bioactivity
Specific activity is determined by a kinetic assay using Hippuryl-L-Arginine as substrate. One unit equals one micromole of Hippuryl-L-Arginine hyrolyzed per minute. Specific activity is reported in Units per milligram. This experiment requires the use of 1 mM substrate and incubation at room temperature for 30 minutes. The specific activity is 14 U/mg. (Activation description: The proenzyme needs to be activated by the mixture of Thrombin (HY-114164) and Human Thrombomodulin (HY-P70724) for an activated form.)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-10*His
-
Accession
Q9EQV9 (F22-S422)
-
Molecular Construction
-
N-term
-
Cpb2 (F22-S422)
Accession # Q9EQV9 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CPB2; Carboxypeptidase B2 (Plasma, Carboxypeptidase U); Carboxypeptidase B2; Thrombin-Activatable Fibrinolysis Inhibitor; PCPB; Carboxypeptidase B2 (Plasma); TAFI; Plasma Carboxypeptidase B; CPU; Carboxypeptidase R; Thrombin-Activable Fibrinolysis Inhibit
-
AA Sequence
FQSGHVLSALPRTSRQVQLLQNLTTTYEVVLWQPVTAEFIEKKKEVHFFVNASDVNSVKAYLNASRIPFNVLMNNVEDLIQQQTSNDTVSPRASSSYYEQYHSLNEIYSWIEVITEQHPDMLQKIYIGSSYEKYPLYVLKVSGKEHRVKNAIWIDCGIHAREWISPAFCLWFIGYVTQFHGKENTYTRLLRHVDFYIMPVMNVDGYDYTWKKNRMWRKNRSVHMNNRCVGTDLNRNFASKHWCEKGASSFSCSETYCGLYPESEPEVKAVADFLRRNINHIKAYISMHSYSQQILFPYSYNRSKSKDHEELSLVASEAVRAIESINKNTRYTHGSGSESLYLAPGGSDDWIYDLGIKYSFTIELRDTGRYGFLLPERFIKPTCAEALAAVSKIAWHVIRNS
-
Molecular Weight
Approximately 55-75 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
