Caspase-7/CASP7 Protein, Human (His)
Based on 1 Customer Validation
Caspase-7/CASP7 protein is a thiol protease involved in programmed cell death processes such as apoptosis, pyroptosis, and granzyme-mediated death. It is activated by initiating caspases (CASP8, CASP9 and/or CASP10) and cleaves CLSPN, PARP1, PTGES3 and YY1, mediating apoptosis. Caspase-7/CASP7 Protein, Human (His) is the recombinant human-derived Caspase-7/CASP7 protein, expressed by E. coli , with C-His labeled tag.
- Species: Human
- Source: E. coli
-
Stockage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Activité biologique
Caspase-7/CASP7 protein is a thiol protease involved in programmed cell death processes such as apoptosis, pyroptosis, and granzyme-mediated death. It is activated by initiating caspases (CASP8, CASP9 and/or CASP10) and cleaves CLSPN, PARP1, PTGES3 and YY1, mediating apoptosis. Caspase-7/CASP7 Protein, Human (His) is the recombinant human-derived Caspase-7/CASP7 protein, expressed by E. coli , with C-His labeled tag.
Caspase-7/CASP7 Protein, a thiol protease, intricately participates in various programmed cell death processes, including apoptosis, pyroptosis, or granzyme-mediated programmed cell death. This multifaceted protein catalyzes the proteolytic cleavage of target proteins, such as CLSPN, PARP1, PTGES3, and YY1, upon activation by initiator caspases (CASP8, CASP9, and/or CASP10), thereby mediating the execution phase of apoptosis. Notably, CASP7 displays a preference for Asp-Glu-Val-Asp (DEVD) consensus sequences and exhibits plasticity for alternate non-canonical sequences. In the inflammatory response to bacterial infection, CASP7 plays a crucial role by cleaving and activating sphingomyelin phosphodiesterase SMPD1 in the extracellular milieu, promoting membrane repair. Moreover, CASP7 regulates pyroptosis in intestinal epithelial cells and granzyme-mediated programmed cell death in hepatocytes, contributing to membrane repair and counteracting the action of gasdermin-D (GSDMD) pores and perforin (PRF1) pores, respectively. Additionally, CASP7 inhibits type I interferon production during virus-induced apoptosis by cleaving antiviral proteins CGAS, IRF3, and MAVS. Despite its diverse roles, CASP7 lacks enzymatic activity itself.
Measured by its ability to cleave the fluorogenic peptide substrate Ac-DEVD-AFC (HY-P1005) that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 15081.12 pmol/min/µg. (Activation description: The proenzyme needs to be activated by Caspase 8 protein)
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-10*His
-
Accession
P55210 (M1-Q303)
-
Molecular Construction
-
N-term
-
CASP7 (M1-Q303)
Accession # P55210 -
10*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CASP7; ICE-Like Apoptotic Protease 3; Caspase 7; Caspase-7; ICE-LAP3; CASP-7; CMH-1; Apoptotic Protease MCH-3; MCH3; Apoptotic Protease Mch-3; Caspase 7, Apoptosis-Related Cysteine Peptidase; LICE2; Caspase 7, Apoptosis-Related Cysteine Protease
-
AA Sequence
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
-
Predicted Molecular Mass
35 kDa
-
Masse moléculaire
Approximately 20 kDa & 11 kDa, based on SDS-PAGE under reducing conditions.
-
Pureté
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 100 mM NaCl, 1 mM EDTA, 0.1 % Sucrose, 0.1% chaps, pH 7.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 100 mM NaCl, pH 7.5, 1 mM EDTA ,0.1% Sucrose, 0.1% Chaps ,8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Fiche technique (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Instruction de manipulation (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)