Caspase-7/CASP7 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

Caspase-7/CASP7 protein is a thiol protease involved in programmed cell death processes such as apoptosis, pyroptosis, and granzyme-mediated death. It is activated by initiating caspases (CASP8, CASP9 and/or CASP10) and cleaves CLSPN, PARP1, PTGES3 and YY1, mediating apoptosis. Caspase-7/CASP7 Protein, Human (His) is the recombinant human-derived Caspase-7/CASP7 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Caspase-7/CASP7 protein is a thiol protease involved in programmed cell death processes such as apoptosis, pyroptosis, and granzyme-mediated death. It is activated by initiating caspases (CASP8, CASP9 and/or CASP10) and cleaves CLSPN, PARP1, PTGES3 and YY1, mediating apoptosis. Caspase-7/CASP7 Protein, Human (His) is the recombinant human-derived Caspase-7/CASP7 protein, expressed by E. coli , with C-His labeled tag.

Background

Caspase-7/CASP7 Protein, a thiol protease, intricately participates in various programmed cell death processes, including apoptosis, pyroptosis, or granzyme-mediated programmed cell death. This multifaceted protein catalyzes the proteolytic cleavage of target proteins, such as CLSPN, PARP1, PTGES3, and YY1, upon activation by initiator caspases (CASP8, CASP9, and/or CASP10), thereby mediating the execution phase of apoptosis. Notably, CASP7 displays a preference for Asp-Glu-Val-Asp (DEVD) consensus sequences and exhibits plasticity for alternate non-canonical sequences. In the inflammatory response to bacterial infection, CASP7 plays a crucial role by cleaving and activating sphingomyelin phosphodiesterase SMPD1 in the extracellular milieu, promoting membrane repair. Moreover, CASP7 regulates pyroptosis in intestinal epithelial cells and granzyme-mediated programmed cell death in hepatocytes, contributing to membrane repair and counteracting the action of gasdermin-D (GSDMD) pores and perforin (PRF1) pores, respectively. Additionally, CASP7 inhibits type I interferon production during virus-induced apoptosis by cleaving antiviral proteins CGAS, IRF3, and MAVS. Despite its diverse roles, CASP7 lacks enzymatic activity itself.

Verified Bioactivity

Measured by its ability to cleave the fluorogenic peptide substrate Ac-DEVD-AFC (HY-P1005) that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 15081.12 pmol/min/µg. (Activation description: The proenzyme needs to be activated by Caspase 8 protein)

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-10*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CASP7 (M1-Q303)
      Accession # P55210
    • 10*His
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CASP7; ICE-Like Apoptotic Protease 3; Caspase 7; Caspase-7; ICE-LAP3; CASP-7; CMH-1; Apoptotic Protease MCH-3; MCH3; Apoptotic Protease Mch-3; Caspase 7, Apoptosis-Related Cysteine Peptidase; LICE2; Caspase 7, Apoptosis-Related Cysteine Protease

  • AA Sequence

    MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

  • Predicted Molecular Mass

    35 kDa

  • Molecular Weight

    Approximately 20 kDa & 11 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 100 mM NaCl, 1 mM EDTA, 0.1 % Sucrose, 0.1% chaps, pH 7.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 100 mM NaCl, pH 7.5, 1 mM EDTA ,0.1% Sucrose, 0.1% Chaps ,8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00