Caspase-7/CASP7 Protein, Human (His)
Based on 1 Customer Validation
Caspase-7/CASP7 protein is a thiol protease involved in programmed cell death processes such as apoptosis, pyroptosis, and granzyme-mediated death. It is activated by initiating caspases (CASP8, CASP9 and/or CASP10) and cleaves CLSPN, PARP1, PTGES3 and YY1, mediating apoptosis. Caspase-7/CASP7 Protein, Human (His) is the recombinant human-derived Caspase-7/CASP7 protein, expressed by E. coli , with C-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Caspase-7/CASP7 protein is a thiol protease involved in programmed cell death processes such as apoptosis, pyroptosis, and granzyme-mediated death. It is activated by initiating caspases (CASP8, CASP9 and/or CASP10) and cleaves CLSPN, PARP1, PTGES3 and YY1, mediating apoptosis. Caspase-7/CASP7 Protein, Human (His) is the recombinant human-derived Caspase-7/CASP7 protein, expressed by E. coli , with C-His labeled tag.
Background
Caspase-7/CASP7 Protein, a thiol protease, intricately participates in various programmed cell death processes, including apoptosis, pyroptosis, or granzyme-mediated programmed cell death. This multifaceted protein catalyzes the proteolytic cleavage of target proteins, such as CLSPN, PARP1, PTGES3, and YY1, upon activation by initiator caspases (CASP8, CASP9, and/or CASP10), thereby mediating the execution phase of apoptosis. Notably, CASP7 displays a preference for Asp-Glu-Val-Asp (DEVD) consensus sequences and exhibits plasticity for alternate non-canonical sequences. In the inflammatory response to bacterial infection, CASP7 plays a crucial role by cleaving and activating sphingomyelin phosphodiesterase SMPD1 in the extracellular milieu, promoting membrane repair. Moreover, CASP7 regulates pyroptosis in intestinal epithelial cells and granzyme-mediated programmed cell death in hepatocytes, contributing to membrane repair and counteracting the action of gasdermin-D (GSDMD) pores and perforin (PRF1) pores, respectively. Additionally, CASP7 inhibits type I interferon production during virus-induced apoptosis by cleaving antiviral proteins CGAS, IRF3, and MAVS. Despite its diverse roles, CASP7 lacks enzymatic activity itself.
Verified Bioactivity
Measured by its ability to cleave the fluorogenic peptide substrate Ac-DEVD-AFC (HY-P1005) that incubate at room temperature in kinetic mode for 5 minutes. The specific activity is 15081.12 pmol/min/µg. (Activation description: The proenzyme needs to be activated by Caspase 8 protein)
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-10*His
-
Accession
P55210 (M1-Q303)
-
Molecular Construction
-
N-term
-
CASP7 (M1-Q303)
Accession # P55210 -
10*His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CASP7; ICE-Like Apoptotic Protease 3; Caspase 7; Caspase-7; ICE-LAP3; CASP-7; CMH-1; Apoptotic Protease MCH-3; MCH3; Apoptotic Protease Mch-3; Caspase 7, Apoptosis-Related Cysteine Peptidase; LICE2; Caspase 7, Apoptosis-Related Cysteine Protease
-
AA Sequence
MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ
-
Predicted Molecular Mass
35 kDa
-
Molecular Weight
Approximately 20 kDa & 11 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
1.Lyophilized from a 0.2 μm filtered solution of 20 mM HEPES, 100 mM NaCl, 1 mM EDTA, 0.1 % Sucrose, 0.1% chaps, pH 7.5, 5% trehalose, 5% mannitol and 0.01% Tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM HEPES, 100 mM NaCl, pH 7.5, 1 mM EDTA ,0.1% Sucrose, 0.1% Chaps ,8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
