1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3) Caspase
  4. Caspase 7
  5. Caspase-7/CASP7 Protein, Human (His)

Caspase-7/CASP7 protein is a thiol protease involved in programmed cell death processes such as apoptosis, pyroptosis, and granzyme-mediated death. It is activated by initiating caspases (CASP8, CASP9 and/or CASP10) and cleaves CLSPN, PARP1, PTGES3 and YY1, mediating apoptosis. Caspase-7/CASP7 Protein, Human (His) is the recombinant human-derived Caspase-7/CASP7 protein, expressed by E. coli , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Caspase-7/CASP7 protein is a thiol protease involved in programmed cell death processes such as apoptosis, pyroptosis, and granzyme-mediated death. It is activated by initiating caspases (CASP8, CASP9 and/or CASP10) and cleaves CLSPN, PARP1, PTGES3 and YY1, mediating apoptosis. Caspase-7/CASP7 Protein, Human (His) is the recombinant human-derived Caspase-7/CASP7 protein, expressed by E. coli , with C-His labeled tag.

Background

Caspase-7/CASP7 Protein, a thiol protease, intricately participates in various programmed cell death processes, including apoptosis, pyroptosis, or granzyme-mediated programmed cell death. This multifaceted protein catalyzes the proteolytic cleavage of target proteins, such as CLSPN, PARP1, PTGES3, and YY1, upon activation by initiator caspases (CASP8, CASP9, and/or CASP10), thereby mediating the execution phase of apoptosis. Notably, CASP7 displays a preference for Asp-Glu-Val-Asp (DEVD) consensus sequences and exhibits plasticity for alternate non-canonical sequences. In the inflammatory response to bacterial infection, CASP7 plays a crucial role by cleaving and activating sphingomyelin phosphodiesterase SMPD1 in the extracellular milieu, promoting membrane repair. Moreover, CASP7 regulates pyroptosis in intestinal epithelial cells and granzyme-mediated programmed cell death in hepatocytes, contributing to membrane repair and counteracting the action of gasdermin-D (GSDMD) pores and perforin (PRF1) pores, respectively. Additionally, CASP7 inhibits type I interferon production during virus-induced apoptosis by cleaving antiviral proteins CGAS, IRF3, and MAVS. Despite its diverse roles, CASP7 lacks enzymatic activity itself.

Species

Human

Source

E. coli

Tag

C-10*His

Accession

P55210 (M1-Q303)

Gene ID

840  [NCBI]

Molecular Construction
N-term
CASP7 (M1-Q303)
Accession # P55210
10*His
C-term
Protein Length

Full Length

Synonyms
CMH-1; CASP-7; Caspase-7; MCH3; ICE-LAP3
AA Sequence

MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCFRSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRSPGRGSWFVQALCSILEEHGKDLEIMQILTRVNDRVARHFESQSDDPHFHEKKQIPCVVSMLTKELYFSQ

Predicted Molecular Mass
35 kDa
Molecular Weight

Approximately 20 kDa (N-reminal P20 subunit) & 12 kDa (C-teminal p11 subunit),based on SDS-PAGE under reducing conditions, as a result of proteolytic cleavage.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Caspase-7/CASP7 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Caspase-7/CASP7 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Caspase-7/CASP7 Protein, Human (His)
Cat. No.:
HY-P74347
Quantity:
MCE Japan Authorized Agent: