TARC/CCL17 Protein, Rat (His)

Customer Review

Based on 1 Customer Validation

CCL17 protein is a chemokine with selective chemotactic activity towards Th2 cells and plays a crucial role in various inflammatory and immune processes. It coordinates immune responses by binding to CCR4 on the surface of T cells. TARC/CCL17 Protein, Rat (His) is the recombinant rat-derived TARC/CCL17 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CCL17 protein is a chemokine with selective chemotactic activity towards Th2 cells and plays a crucial role in various inflammatory and immune processes. It coordinates immune responses by binding to CCR4 on the surface of T cells. TARC/CCL17 Protein, Rat (His) is the recombinant rat-derived TARC/CCL17 protein, expressed by E. coli , with N-6*His labeled tag.

Background

The CCL17 protein functions as a chemokine, demonstrating chemotactic activity for T lymphocytes, particularly favoring Th2 cells over monocytes or granulocytes. This specificity underscores its crucial role in a diverse array of inflammatory and immunological processes. Operating through the binding to CCR4 on the T-cell surface, CCL17 actively participates in orchestrating immune responses. Additionally, CCL17 plays a role in mediating GM-CSF/CSF2-driven pain and inflammation, and in the brain, it is indispensable for maintaining the typical highly branched morphology of hippocampal microglia under homeostatic conditions. Moreover, CCL17 may be pivotal for the appropriate adaptation of microglial morphology and synaptic plasticity in response to acute lipopolysaccharide (LPS)-induced neuroinflammation. Furthermore, CCL17 contributes to wound healing by inducing fibroblast migration into the wound, further highlighting its multifaceted involvement in immune regulation and tissue repair processes.

Verified Bioactivity

1.Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T-lymphocytes is in a concentration range of 1.0-10 ng/mL.
2.Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is approximately 0.6155 ng/mL, corresponding to a specific activity is 1.62×106 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract Jurkat cells. The ED50 for this effect is approximately 0.6155 ng/mL, corresponding to a specific activity is 1.62×106 U/mg.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CCL17 (A24-L93)
      Accession # Q9ERE0
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CCL17; Chemokine (C-C Motif) Ligand 17; Prev. SCYA17; C-C Motif Chemokine 17; TARC; CC Chemokine TARC; ABCD-2; T Cell-Directed CC Chemokine; Small Inducible Cytokine Subfamily A (Cys-Cys), Member 17; A-152E5.3; Thymus And Activation-Regulated Chemokine; C

  • AA Sequence

    ARATNVGRECCLDYFKGAIPIRKLVTWFRTSVECPKDAIVFETVQGRLICTDPKDKHVKKAIRHLKNQRL

  • Predicted Molecular Mass

    8.1 kDa

  • Molecular Weight

    Approximately 12 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm solution of PBS, pH 7.4 or 50 mM Tris-HCl, 300 mM NaCl, 200 mM arginine, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00