CTACK/CCL27 Protein, Human (His)
CTACK/CCL27 protein selectively attracts skin-associated memory T-lymphocytes, mediating their homing to cutaneous sites through CCR10 binding. Crucial for skin immunity regulation, CCL27 exists as a monomer, dimer, and tetramer, with heparin promoting its oligomerization. Interaction with TNFAIP6, particularly through its Link domain, implies regulatory roles in skin immune responses and inflammation within the skin microenvironment. CTACK/CCL27 Protein, Human (His) is the recombinant human-derived CTACK/CCL27 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CTACK/CCL27 protein selectively attracts skin-associated memory T-lymphocytes, mediating their homing to cutaneous sites through CCR10 binding. Crucial for skin immunity regulation, CCL27 exists as a monomer, dimer, and tetramer, with heparin promoting its oligomerization. Interaction with TNFAIP6, particularly through its Link domain, implies regulatory roles in skin immune responses and inflammation within the skin microenvironment. CTACK/CCL27 Protein, Human (His) is the recombinant human-derived CTACK/CCL27 protein, expressed by E. coli , with N-His labeled tag.
CCL27 protein functions as a chemotactic factor specifically attracting skin-associated memory T-lymphocytes and is implicated in mediating the homing of lymphocytes to cutaneous sites. Through its binding to CCR10, CCL27 orchestrates the migration of immune cells in the skin, indicating its pivotal role in the regulation of skin immunity. Existing as a monomer, dimer, and tetramer, the protein's oligomerization is avidly promoted by heparin. Additionally, CCL27 interacts with TNFAIP6, specifically through its Link domain, suggesting potential regulatory roles in the context of immune responses and inflammatory processes within the skin microenvironment.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q9Y4X3 (F25-G112)
-
Molecular Construction
-
N-term
-
His
-
CCL27 (F25-G112)
Accession # Q9Y4X3 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CCL27; CC Chemokine ILC; Prev. SCYA27; Cutaneous T-Cell Attracting Chemokine; CTACK; IL-11 R-Alpha-Locus Chemokine; ILC; IL-11 Ralpha-Locus Chemokine; Skinkine; Small-Inducible Cytokine A27; ESkine; C-C Motif Chemokine 27; PESKY; Cutaneous T-Cell-Attracti
-
AA Sequence
FLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
-
Predicted Molecular Mass
12.2 kDa
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
