1. Recombinant Proteins
  2. CD Antigens Biotinylated Proteins
  3. T Cell CD Proteins Macrophage CD Proteins Dendritic Cell CD Proteins
  4. CD8a
  5. CD8 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)

CD8 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P78898
Handling Instructions Technical Support

CD8A is an important immune glycoprotein that acts as a coreceptor for class I MHC:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CD8 alpha protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

CD8A is an important immune glycoprotein that acts as a coreceptor for class I MHC:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived CD8 alpha protein, expressed by HEK293 , with C-Avi, C-His labeled tag.

Background

The CD8A, an integral membrane glycoprotein, plays a critical role in the immune response, fulfilling multiple functions in responses against both external and internal threats. In T-cells, it primarily functions as a coreceptor for the MHC class I molecule:peptide complex, interacting simultaneously with the T-cell receptor (TCR) and the MHC class I proteins presented by antigen-presenting cells (APCs). This interaction leads to the recruitment of the Src kinase LCK to the vicinity of the TCR-CD3 complex. LCK, in turn, initiates diverse intracellular signaling pathways, phosphorylating various substrates and ultimately promoting lymphokine production, motility, adhesion, and activation of cytotoxic T-lymphocytes (CTLs). This mechanism enables CTLs to recognize and eliminate infected cells and tumor cells. In NK-cells, the presence of CD8A homodimers at the cell surface provides a survival mechanism allowing the conjugation and lysis of multiple target cells. CD8A homodimer molecules also contribute to the survival and differentiation of activated lymphocytes into memory CD8 T-cells. The CD8A forms disulfide-linked complexes at the cell surface and also homodimers in various cell types, including NK-cells and peripheral blood T-lymphocytes. It interacts with the MHC class I HLA-A/B2M dimer and with LCK in a zinc-dependent manner.

Species

Mouse

Source

HEK293

Tag

C-Avi;C-His

Accession

P01731-1 (K28-Y196)

Gene ID
Protein Length

Extracellular Domain

Conjugation

Biotin

Synonyms
CD8A; CD8; Leu2; MAL; p32
AA Sequence

KPQAPELRIFPKKMDAELGQKVDLVCEVLGSVSQGCSWLFQNSSSKLPQPTFVVYMASSHNKITWDEKLNSSKLFSAMRDTNNKYVLTLNKFSKENEGYYFCSVISNSVMYFSSVVPVLQKVNSTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY

Molecular Weight

34-40 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

CD8 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD8 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD8 alpha Protein, Mouse (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P78898
Quantity:
MCE Japan Authorized Agent: