CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi)
CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived CEACAM8/CD66b protein, expressed by sf9 insect cells , with C-Avi, C-His labeled tag. The total length of CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi) is 285 a.a., with molecular weight of 55-66 kDa.
- Species: Human
- Source: sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived CEACAM8/CD66b protein, expressed by sf9 insect cells , with C-Avi, C-His labeled tag. The total length of CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi) is 285 a.a., with molecular weight of 55-66 kDa.
Background
CEACAM8/CD66b protein, a cell surface glycoprotein, actively contributes to cell adhesion in a calcium-independent manner. It primarily mediates heterophilic cell adhesion, forming interactions with other carcinoembryonic antigen-related cell adhesion molecules, including CEACAM6. Notably, the heterophilic interaction with CEACAM8 takes place specifically in activated neutrophils. CEACAM8 operates as a monomer and also forms heterodimers with CEACAM6, engaging in heterodimerization through its Ig-like V-type domain. This emphasizes its role as a versatile cell adhesion molecule, participating in interactions with various partners and highlighting its significance in diverse cellular contexts, particularly in activated neutrophils and during heterophilic adhesion with other CEACAM family members.
Technical Parameters
-
Species Human
-
Source sf9 insect cells
-
Tag C-Avi;C-His
-
Accession
P31997 (Q35-S319)
-
Protein Length
Full Length of Mature Protein
-
Conjugation
Biotin
-
Synonyms
CEACAM8; Carcinoembryonic Antigen CGM6; Prev. CGM6; CDNA, FLJ93041, Homo Sapiens Carcinoembryonic Antigen-Related Cell Adhesionmolecule 8 (CEACAM8), MRNA; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 8; Carcinoembryonic Antigen Gene Family Memb
-
AA Sequence
QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS
-
Predicted Molecular Mass
35.1 kDa
-
Molecular Weight
Approximately 55-66 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
