1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Biotinylated Proteins
  3. Stem Cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. CEACAM8/NCA-95/CD66b Immunoglobulin-like Cell Adhesion Molecules
  5. CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi)

CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi)

Art. -Nr.: HY-P78893
Handling Instructions Technical Support

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived CEACAM8/CD66b protein, expressed by sf9 insect cells , with C-Avi, C-His labeled tag. The total length of CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi) is 285 a.a., with molecular weight of 55-66 kDa.

Nur für Forschungszwecke. Wir verkaufen nicht an Patienten.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Größe Preis Verfügbarkeit Menge
25 μg Angebot einholen 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Angebot einholen 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Angebot einholen  
Synthetic products have potential research and development risk.

* Bitte wählen Sie Menge, bevor Sie Artikel hinzufügen.

Top Publications Citing Use of Products
  • Biologische Aktivität

  • Technical Parameters

  • Properties

  • Beschreibung

Beschreibung

CEACAM8/CD66b protein is a cell surface glycoprotein that promotes calcium-independent heterophil cell adhesion to other carcinoembryonic antigen-related cell adhesion molecules, particularly CEACAM6, in activated neutrophils Especially obvious. CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived CEACAM8/CD66b protein, expressed by sf9 insect cells , with C-Avi, C-His labeled tag. The total length of CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi) is 285 a.a., with molecular weight of 55-66 kDa.

Background

CEACAM8/CD66b protein, a cell surface glycoprotein, actively contributes to cell adhesion in a calcium-independent manner. It primarily mediates heterophilic cell adhesion, forming interactions with other carcinoembryonic antigen-related cell adhesion molecules, including CEACAM6. Notably, the heterophilic interaction with CEACAM8 takes place specifically in activated neutrophils. CEACAM8 operates as a monomer and also forms heterodimers with CEACAM6, engaging in heterodimerization through its Ig-like V-type domain. This emphasizes its role as a versatile cell adhesion molecule, participating in interactions with various partners and highlighting its significance in diverse cellular contexts, particularly in activated neutrophils and during heterophilic adhesion with other CEACAM family members.

Biologische Aktivität

Immobilized Human CEACAM-6 His at 10 μg/mL (100 μL/well) can bind Biotinylated Human CEACAM-8 His-Avi with a linear range of 0.02-0.313 μg/mL.

Species

Human

Source

sf9 insect cells

Tag

C-Avi;C-His

Accession

P31997 (Q35-S319)

Gene ID
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Synonyms
CEACAM8; CD66b; CD67; CGM6; NCA-95
AA Sequence

QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS

Molekulargewicht

55-66 kDa

Reinheit

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Versand

Room temperature in continental US; may vary elsewhere.

Dokumentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Ihre kürzlich angesehenen Produkte:

Online-Anfrage

Your information is safe with us. * Required Fields.

CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi)

 

Requested Quantity *

Name des Antragstellers *

 

Anrede

E-Mail-Addresse *

 

Telefonnummer *

Department

 

Name der Organisation *

City

Bundesland

Country or Region *

     

Bemerkungen

Massenanfrage

Inquiry Information

Produktname:
CEACAM8/CD66b Protein, Human (Biotinylated, sf9, His-Avi)
Art. -Nr.:
HY-P78893
Menge:
MCE Japan Authorized Agent: