CLEC4C Protein, Human (His-SUMO)
Based on 1 Customer Validation
CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Human (His-SUMO) is the recombinant human-derived CLEC4C protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CLEC4C is a lectin-type cell surface receptor that plays a crucial role in antigen capture by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans with the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. CLEC4C Protein, Human (His-SUMO) is the recombinant human-derived CLEC4C protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.
Background
The CLEC4C protein functions as a lectin-type cell surface receptor and is implicated in antigen capturing by dendritic cells. It specifically recognizes non-sialylated galactose-terminated biantennary glycans that contain the trisaccharide epitope Gal(beta1-3/4)GlcNAc(beta1-2)Man. Additionally, CLEC4C binds to serum IgG and efficiently targets ligands into antigen-processing and peptide-loading compartments for presentation to T-cells. Notably, it may mediate potent inhibition of the induction of IFN-alpha/beta expression in plasmacytoid dendritic cells and act as a signaling receptor, activating protein-tyrosine kinases and mobilizing intracellular calcium. The protein forms homodimers, underscoring its potential significance in cellular signaling and immune response modulation.
Verified Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 2 μg/mL can bind human IgG, the EC50 of human IgG is 3.358-4.383 ng/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-SUMO;N-6*His
-
Accession
Q8WTT0-1 (N45-I213)
-
Molecular Construction
-
N-term
-
6*His-SUMO
-
CLEC4C (N45-I213)
Accession # Q8WTT0-1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CLEC4C; Dendritic Lectin; Prev. CLECSF11; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 11; Prev. CLECSF7; C-Type Lectin Domain Family 4, Member C; BDCA2; Blood Dendritic Cell Antigen 2 Protein; HECL; Blood Dendrit
-
AA Sequence
NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI
-
Predicted Molecular Mass
36 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)