Creatine kinase M-type/CKM Protein, Human (His)
Based on 1 Customer Validation
Creatine kinase M-type/CKM Protein, Human (His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by E. coli, with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Creatine kinase M-type/CKM Protein, Human (His) is the recombinant human-derived Creatine kinase M-type/CKM protein, expressed by E. coli, with N-His labeled tag.
Background
KCRM is a cytoplasmic creatine kinase isoenzyme that reversibly catalyzes phosphate transfer between ATP and various phosphogens (e.g., creatine phosphate). KCRM is involved in energy transduction and energy homeostasis in tissues with large and fluctuating energy demands, such as skeletal muscle, heart, brain, and sperm, and is an important serum marker of myocardial infarction. KCRM acts as a homodimer in striated muscle and other tissues and as a heterodimer in the heart with similar brain isozymes. Skeletal muscle, as an important secretory organ, differentially secretes cleaved KCRM peptide in type 2 diabetes mellitus (T2DM) skeletal muscle tissue. Naturally occurring mutations in KCRM may render individuals with active serum creatine kinase unresponsive to Tenofovir (HY-13910) pre-exposure prophylaxis (PrEP) HIV.
Verified Bioactivity
Measured by its ability to phosphorylate creatine. The specific activity is 3604.044 pmol/min/μg, as measured under the described conditions.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
AAH07462.1 (M1-K381)
-
Molecular Construction
-
N-term
-
His
-
CKM (M1-K381)
Accession # AAH07462.1 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CKM; Creatine Kinase M Chain; Prev. CKMM; CPK-M; Creatine Phosphokinase M-Type; M-CK; Creatine Kinase, Muscle; Creatine Kinase, M-Type; Creatine Kinase M-Type; rHuCreatine kinase M-type/CKMM, His
-
AA Sequence
MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSLLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
-
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 50 mM HEPES, 300 mM NaCl, pH 7.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
