CYB5B Protein, Human (HEK293, His)

CYB5B Protein, Human (HEK293, His) is the recombinant human-derived CYB5B protein, expressed by HEK293, with C-6*His labeled tag.

Cytochrome b5 type B (CYB5B) is an outer membrane mitochondrial protein, which is the mitochondrial form of Cytochrome b5 (CYB5). CYB5B is a donor of electrons to cytoglobin and expresses in arteriolar ECs and VSMCs. CYB5B may be a potential target for antibody-based therapy of HL and aggressive NHL. Since normal lymphocytes and bone marrow precursor cells lack surface expression of CYB5B, little or no toxicity should be observed during anti-CYB5B immunotherapy. CYB5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases and is a key determinant of human P450 activity in vivo^[1][2][3][4].

Human

HEK293

C-6*His

AAH04373.1 (K12-C118)

80777  [NCBI]

Partial

KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSC

Approximately 22 kDa,based on SDS-PAGE under reducing conditions.

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.