CYB5B Protein, Human (HEK293, His)

CYB5B Protein, Human (HEK293, His) is the recombinant human-derived CYB5B protein, expressed by HEK293, with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CYB5B Protein, Human (HEK293, His) is the recombinant human-derived CYB5B protein, expressed by HEK293, with C-6*His labeled tag.

Background

Cytochrome b5 type B (CYB5B) is an outer membrane mitochondrial protein, which is the mitochondrial form of Cytochrome b5 (CYB5). CYB5B is a donor of electrons to cytoglobin and expresses in arteriolar ECs and VSMCs. CYB5B may be a potential target for antibody-based therapy of HL and aggressive NHL. Since normal lymphocytes and bone marrow precursor cells lack surface expression of CYB5B, little or no toxicity should be observed during anti-CYB5B immunotherapy. CYB5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases and is a key determinant of human P450 activity in vivo[1][2][3][4].

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CYB5B (K12-C118)
      Accession # AAH04373.1
    • 6*His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CYB5B; Cytochrome B5 Outer Mitochondrial Membrane Isoform; Cytochrome B5 Type B; Outer Mitochondrial Membrane Cytochrome B5; CYB5-M; Type 2 Cyt-B5; Cytochrome B5 Type B (Outer Mitochondrial Membrane); CYPB5M; OMB5; CYB5M

  • AA Sequence

    KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSC

  • Predicted Molecular Mass

    13.1 kDa

  • Molecular Weight

    Approximately 22 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00