CYB5B Protein, Human (HEK293, His)
CYB5B Protein, Human (HEK293, His) is the recombinant human-derived CYB5B protein, expressed by HEK293, with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CYB5B Protein, Human (HEK293, His) is the recombinant human-derived CYB5B protein, expressed by HEK293, with C-6*His labeled tag.
Background
Cytochrome b5 type B (CYB5B) is an outer membrane mitochondrial protein, which is the mitochondrial form of Cytochrome b5 (CYB5). CYB5B is a donor of electrons to cytoglobin and expresses in arteriolar ECs and VSMCs. CYB5B may be a potential target for antibody-based therapy of HL and aggressive NHL. Since normal lymphocytes and bone marrow precursor cells lack surface expression of CYB5B, little or no toxicity should be observed during anti-CYB5B immunotherapy. CYB5 is a membrane-bound hemoprotein functioning as an electron carrier for several membrane-bound oxygenases and is a key determinant of human P450 activity in vivo[1][2][3][4].
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
AAH04373.1 (K12-C118)
-
Molecular Construction
-
N-term
-
CYB5B (K12-C118)
Accession # AAH04373.1 -
6*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CYB5B; Cytochrome B5 Outer Mitochondrial Membrane Isoform; Cytochrome B5 Type B; Outer Mitochondrial Membrane Cytochrome B5; CYB5-M; Type 2 Cyt-B5; Cytochrome B5 Type B (Outer Mitochondrial Membrane); CYPB5M; OMB5; CYB5M
-
AA Sequence
KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSC
-
Predicted Molecular Mass
13.1 kDa
-
Molecular Weight
Approximately 22 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
