CCNA2 Protein, Human
CCNA2 Protein, Human is the recombinant human-derived CCNA2 protein, expressed by E. coli, with tag free tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
CCNA2 Protein, Human is the recombinant human-derived CCNA2 protein, expressed by E. coli, with tag free tag.
Background
CCNA2 is a cyclin that regulates both the G1/S and G2/M transition phases of the cell cycle. It functions by forming specific serine/threonine protein kinase holoenzyme complexes with the cyclin-dependent protein kinases CDK1 or CDK2. The cyclin subunit confers substrate specificity to these complexes and differentially interacts with and activates CDK1 and CDK2 throughout the cell cycle.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P20248 (E174-L432)
-
Gene ID890
-
Protein Length
Partial
-
Synonyms
CCNA2; Cyclin-A2; Prev. CCN1; Cyclin A; Prev. CCNA; Cyclin A2; Cyclin-A
-
AA Sequence
EVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLTFDLAAPTVNQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAGAAFHLALYTVTGQSWPESLIRKTGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKNSKYHGVSLLNPPETLNL
-
Predicted Molecular Mass
30.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)