DLK2 Protein, Mouse (P.pastoris, His)
DLK2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived DLK2, expressed by P. pastoris , with N-6*His labeled tag.
- Species: Mouse
- Source: P. pastoris
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DLK2 Protein, Mouse (P.pastoris, His) is the recombinant mouse-derived DLK2, expressed by P. pastoris , with N-6*His labeled tag.
Background
DLK2 is a protein that regulates adipogenesis by influencing the differentiation process of adipocytes. Research suggests that DLK2 may affect adipogenesis by modulating the expression of key transcription factors such as PPARγ and C/EBPα. by similar: DLK1 has also been reported to play a role in adipogenesis, but the mechanism of DLK2 may differ.
Technical Parameters
-
Species Mouse
-
Source P. pastoris
-
Tag N-6*His
-
Accession
Q8K1E3-1 (D27-S305)
-
Gene ID106565
-
Protein Length
Extracellular Domain
-
Synonyms
DLK2; EGF-Like Protein 9; Prev. EGFL9; DLK-2; Epidermal Growth Factor-Like Protein 9; Delta-Like 2 Homolog (Drosophila); Protein Delta Homolog 2; Delta-Like 2 Homolog; EGF-Like-Domain, Multiple 9; Delta Like Non-Canonical Notch Ligand 2; MGC2487
-
AA Sequence
DDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQAGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPASVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESS
-
Predicted Molecular Mass
31.6 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
