DPEP1 Protein, Human (HEK293, His)
Based on 1 Customer Validation
Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Dipeptidase 1 (DPEP1) has multiple enzymatic functions and can hydrolyze various dipeptides, including the conversion of leukotriene D4 to leukotriene E4. It is also involved in the degradation of cysteinylbisglycine resulting from the breakdown of glutathione. DPEP1 Protein, Human (HEK293, His) is the recombinant human-derived DPEP1 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
Dipeptidase 1 (DPEP1) exhibits versatile enzymatic functions, hydrolyzing a broad spectrum of dipeptides, including the conversion of leukotriene D4 to leukotriene E4. Additionally, it plays a role in the degradation of cystinyl-bis-glycine formed during glutathione breakdown. Notably, DPEP1 showcases beta lactamase activity, enabling the hydrolysis of the beta-lactam antibiotic imipenem. Beyond its enzymatic functions, DPEP1 acts as an adhesion receptor, facilitating neutrophil recruitment from the bloodstream into inflamed lungs and liver independently of its dipeptidase activity.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P16444 (D17-S385)
-
Molecular Construction
-
N-term
-
DPEP1 (D17-S385)
Accession # P16444 -
6*His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DPEP1; HRDP; Dipeptidase 1; MDP; Microsomal Dipeptidase; RDP; Dipeptidase 1 (Renal); Testicular Tissue Protein Li 57; Dehydropeptidase-I; Dipeptidase; Renal Dipeptidase; MBD1; Beta-Lactamase
-
AA Sequence
DFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSS
-
Predicted Molecular Mass
42.1 kDa
-
Molecular Weight
Approximately 41 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, 10% glycerol, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
