EPHA5 Protein, Mouse (HEK293, His)
The EPHA5 protein is a multifunctional receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5). EPHA5 exhibits positive signaling, affects axonal guidance during brain development, and promotes synaptic plasticity in the adult brain by regulating synaptogenesis. EPHA5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPHA5 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The EPHA5 protein is a multifunctional receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5). EPHA5 exhibits positive signaling, affects axonal guidance during brain development, and promotes synaptic plasticity in the adult brain by regulating synaptogenesis. EPHA5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPHA5 protein, expressed by HEK293 , with C-His labeled tag.
Background
EPHA5 protein is a promiscuous receptor tyrosine kinase that binds to GPI-anchored ephrin-A ligands on neighboring cells, initiating contact-dependent bidirectional signaling. It exhibits forward signaling, while the ephrin ligand triggers reverse signaling. Among the ephrin-A ligands, EFNA5 is likely the functional ligand for EPHA5. EPHA5 functions as an axon guidance molecule during development, playing a role in the development of various pathways in the brain. It also contributes to synaptic plasticity in the adult brain by regulating synaptogenesis. Furthermore, EPHA5 interacts with EFNA5 to facilitate communication between pancreatic islet cells, thereby regulating glucose-stimulated insulin secretion.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag C-8*His
-
Accession
Q60629 (P27-P412)
-
Molecular Construction
-
N-term
-
EPHA5 (P27-P412)
Accession # Q60629 -
8*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
EPHA5; EHK-1; EPH Receptor A5; EK7; TYRO4; Epididymis Secretory Sperm Binding Protein; EHK1; Tyrosine-Protein Kinase Receptor EHK-1; Hek7; Receptor Protein-Tyrosine Kinase HEK7; CEK7; Receptor Protein-Tyrosine Kinase; Ephrin Type-A Receptor 5; EphA5; EPH
-
AA Sequence
PASLAGCYSAPLKGPLWTCLLLCAALRTLLASPSNEVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDENGRSIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHLAIFPDTITGADSSQLLEVSGSCVNHSVTDDPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQAPSPVTNVKKGKIAKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETSITAEGLKPASVYVFQIRARTAAGYGVFSRRFEFETTPVSVAASNDQSQIP
-
Predicted Molecular Mass
43.9 kDa
-
Molecular Weight
Approximately 48-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
