EPHA5 Protein, Mouse (HEK293, His)

The EPHA5 protein is a multifunctional receptor tyrosine kinase that participates in bidirectional signaling with GPI-anchored ephrin-A ligands (especially EFNA5). EPHA5 exhibits positive signaling, affects axonal guidance during brain development, and promotes synaptic plasticity in the adult brain by regulating synaptogenesis. EPHA5 Protein, Mouse (HEK293, His) is the recombinant mouse-derived EPHA5 protein, expressed by HEK293 , with C-His labeled tag.

EPHA5 protein is a promiscuous receptor tyrosine kinase that binds to GPI-anchored ephrin-A ligands on neighboring cells, initiating contact-dependent bidirectional signaling. It exhibits forward signaling, while the ephrin ligand triggers reverse signaling. Among the ephrin-A ligands, EFNA5 is likely the functional ligand for EPHA5. EPHA5 functions as an axon guidance molecule during development, playing a role in the development of various pathways in the brain. It also contributes to synaptic plasticity in the adult brain by regulating synaptogenesis. Furthermore, EPHA5 interacts with EFNA5 to facilitate communication between pancreatic islet cells, thereby regulating glucose-stimulated insulin secretion.

Mouse

HEK293

C-8*His

Q60629 (P27-P412)

13839  [NCBI]

Extracellular Domain

PASLAGCYSAPLKGPLWTCLLLCAALRTLLASPSNEVNLLDSRTVMGDLGWIAFPKNGWEEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWISNEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDENGRSIKENQYIKIDTIAADESFTELDLGDRVMKLNTEVRDVGPLSKKGFYLAFQDVGACIALVSVRVYYKKCPSVVRHLAIFPDTITGADSSQLLEVSGSCVNHSVTDDPPKMHCSAEGEWLVPIGKCMCKAGYEEKNGTCQAPSPVTNVKKGKIAKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETSITAEGLKPASVYVFQIRARTAAGYGVFSRRFEFETTPVSVAASNDQSQIP

Approximately 48-55 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

<1 EU/μg, determined by LAL method.