HER2/CD340 Protein, Rat (His)
Based on 1 Customer Validation
The HER2/CD340 protein is a key protein tyrosine kinase that is a component of multiple cell surface receptor complexes and requires coreceptors for ligand binding.Its interaction within the neuregulin-receptor complex depends on neuregulin, and GP30 emerges as a potential ligand.HER2/CD340 Protein, Rat (His) is the recombinant rat-derived HER2/CD340 protein, expressed by E.coli , with C-6*His labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The HER2/CD340 protein is a key protein tyrosine kinase that is a component of multiple cell surface receptor complexes and requires coreceptors for ligand binding.Its interaction within the neuregulin-receptor complex depends on neuregulin, and GP30 emerges as a potential ligand.HER2/CD340 Protein, Rat (His) is the recombinant rat-derived HER2/CD340 protein, expressed by E.coli , with C-6*His labeled tag.
Background
HER2/CD340 Protein, a protein tyrosine kinase, serves as a crucial component within various cell surface receptor complexes, necessitating a coreceptor for ligand binding. While an essential element in the neuregulin-receptor complex, it notably requires the presence of neuregulins for interaction. Additionally, GP30 stands out as a potential ligand for this receptor. Beyond its receptor functions, HER2 plays a key role in the regulation of peripheral microtubules (MTs), influencing their outgrowth and stabilization. Upon activation, the MEMO1-RHOA-DIAPH1 signaling pathway induced by ERBB2 phosphorylates and inhibits GSK3B at the cell membrane, preventing the phosphorylation of APC and CLASP2. This, in turn, facilitates the association of membrane-bound APC with the cell membrane, enabling the localization of MACF1 crucial for microtubule capture and stabilization. Furthermore, HER2 exhibits diverse interactions, including its preferential binding to the tyrosine-phosphorylated form of CPNE3 at the cell membrane, particularly in a growth factor heredulin-dependent manner. In the nucleus, HER2 extends its influence to transcriptional regulation, associating with specific sequences in the PTGS2/COX-2 promoter and activating transcription. It is also implicated in the transcriptional activation of CDKN1A, a process involving STAT3 and SRC, contributing to rRNA gene transcription by RNA Pol I and enhancing protein synthesis and cell growth. The multifaceted roles of HER2 highlight its intricate involvement in cellular processes, spanning from membrane dynamics to transcriptional regulation.
Verified Bioactivity
This product does not contain protein kinase domain.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag C-6*His
-
Accession
P06494 (A67-V323)
-
Molecular Construction
-
N-term
-
HER2 (A67-V323)
Accession # P06494 -
6*His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
ERBB2; P185erbB2; Prev. NGL; V-Erb-B2 Avian Erythroblastic Leukemia Viral Oncogene Homolog 2 (Neuro/Glioblastoma Derived Oncogene Homolog); HER2; V-Erb-B2 Erythroblastic Leukemia Viral Oncogene Homolog 2, Neuro/Glioblastoma Derived Oncogene Homolog; NEU;
-
AA Sequence
ANASLSFLQDIQEVQGYMLIAHNQVKRVPLQRLRIVRGTQLFEDKYALAVLDNRDPQDNVAASTPGRTPEGLRELQLRSLTEILKGGVLIRGNPQLCYQDMVLWKDVFRKNNQLAPVDIDTNRSRACPPCAPACKDNHCWGESPEDCQILTGTICTSGCARCKGRLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMHNPEGRYTFGASCVTTCPYNYLSTEVGSCTLVCPPNNQEV
-
Predicted Molecular Mass
29.3 kDa
-
Molecular Weight
Approximately 32 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, 5% trehalose, 4M Urea, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)