HER4 Protein, Human (sf9, GST)

HER4 is an important tyrosine protein kinase receptor for members of the neuregulin and EGF families that directs heart, central nervous system, and mammary gland development. It is critical for myocardial differentiation, postnatal cardiomyocyte proliferation, neural crest cell migration, axon guidance, and mammary gland function. HER4 Protein, Human (sf9, GST) is the recombinant human-derived ERBB4, expressed by Sf9 insect cells, with GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

HER4 is an important tyrosine protein kinase receptor for members of the neuregulin and EGF families that directs heart, central nervous system, and mammary gland development. It is critical for myocardial differentiation, postnatal cardiomyocyte proliferation, neural crest cell migration, axon guidance, and mammary gland function. HER4 Protein, Human (sf9, GST) is the recombinant human-derived ERBB4, expressed by Sf9 insect cells, with GST labeled tag.

Background

HER4, a tyrosine-protein kinase, serves as a pivotal cell surface receptor for neuregulins and EGF family members, playing indispensable roles in the development of the heart, central nervous system, and mammary gland, as well as in gene transcription, cell proliferation, differentiation, migration, and apoptosis. It is essential for normal cardiac muscle differentiation during embryonic development and postnatal cardiomyocyte proliferation. Moreover, HER4 is required for the proper development of the embryonic central nervous system, particularly neural crest cell migration and axon guidance, as well as for mammary gland differentiation and lactation induction. Acting as a receptor for neuregulins NRG1, NRG2, NRG3, NRG4, and EGF family members BTC, EREG, and HBEGF, ligand binding triggers receptor dimerization and autophosphorylation, creating multiple combinations of intracellular phosphotyrosines that elicit ligand- and context-specific cellular responses. HER4 mediates phosphorylation of SHC1 and activates the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Isoforms JM-A CYT-1 and JM-B CYT-1 phosphorylate PIK3R1, activating phosphatidylinositol 3-kinase and AKT1 to protect against apoptosis and promote cell migration in response to NRG1. Isoforms JM-A CYT-2 and JM-B CYT-2 lack the phosphotyrosine necessary for PIK3R1 interaction, thus foregoing these effects. Proteolytic processing of isoforms JM-A CYT-1 and JM-A CYT-2 yields soluble intracellular domains (4ICD) that translocate to the nucleus, promoting nuclear import of STAT5A, mammary epithelium differentiation, cell proliferation, and gene expression activation. Additionally, ERBB4 soluble intracellular domains can translocate to mitochondria, inducing apoptosis.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag GST
  • Accession
  • Gene ID
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    ERBB4; Proto-Oncogene-Like Protein C-ErbB-4; Erb-B2 Receptor Tyrosine Kinase 4; P180erbB4; HER4; V-Erb-A Avian Erythroblastic Leukemia Viral Oncogene Homolog-Like 4; ALS19; Avian Erythroblastic Leukemia Viral (V-Erb-B2) Oncogene Homolog 4; V-Erb-B2 Avian

  • AA Sequence

    RRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV

  • Purity

    ≥ 70%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00