1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins Enzymes & Regulators Kinases
  3. EGF Superfamily Receptor Tyrosine Kinases Cytokine Receptors Transferases (EC 2) Protein Tyrosine Kinases TK
  4. EGFR/ErbB family
  5. ErbB4/HER4
  6. HER4 Protein, Human (sf9, GST)

HER4 is an important tyrosine protein kinase receptor for members of the neuregulin and EGF families that directs heart, central nervous system, and mammary gland development. It is critical for myocardial differentiation, postnatal cardiomyocyte proliferation, neural crest cell migration, axon guidance, and mammary gland function. HER4 Protein, Human (sf9, GST) is the recombinant human-derived ERBB4, expressed by Sf9 insect cells, with GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

HER4 is an important tyrosine protein kinase receptor for members of the neuregulin and EGF families that directs heart, central nervous system, and mammary gland development. It is critical for myocardial differentiation, postnatal cardiomyocyte proliferation, neural crest cell migration, axon guidance, and mammary gland function. HER4 Protein, Human (sf9, GST) is the recombinant human-derived ERBB4, expressed by Sf9 insect cells, with GST labeled tag.

Background

HER4, a tyrosine-protein kinase, serves as a pivotal cell surface receptor for neuregulins and EGF family members, playing indispensable roles in the development of the heart, central nervous system, and mammary gland, as well as in gene transcription, cell proliferation, differentiation, migration, and apoptosis. It is essential for normal cardiac muscle differentiation during embryonic development and postnatal cardiomyocyte proliferation. Moreover, HER4 is required for the proper development of the embryonic central nervous system, particularly neural crest cell migration and axon guidance, as well as for mammary gland differentiation and lactation induction. Acting as a receptor for neuregulins NRG1, NRG2, NRG3, NRG4, and EGF family members BTC, EREG, and HBEGF, ligand binding triggers receptor dimerization and autophosphorylation, creating multiple combinations of intracellular phosphotyrosines that elicit ligand- and context-specific cellular responses. HER4 mediates phosphorylation of SHC1 and activates the MAP kinases MAPK1/ERK2 and MAPK3/ERK1. Isoforms JM-A CYT-1 and JM-B CYT-1 phosphorylate PIK3R1, activating phosphatidylinositol 3-kinase and AKT1 to protect against apoptosis and promote cell migration in response to NRG1. Isoforms JM-A CYT-2 and JM-B CYT-2 lack the phosphotyrosine necessary for PIK3R1 interaction, thus foregoing these effects. Proteolytic processing of isoforms JM-A CYT-1 and JM-A CYT-2 yields soluble intracellular domains (4ICD) that translocate to the nucleus, promoting nuclear import of STAT5A, mammary epithelium differentiation, cell proliferation, and gene expression activation. Additionally, ERBB4 soluble intracellular domains can translocate to mitochondria, inducing apoptosis.

Species

Human

Source

Sf9 insect cells

Tag

GST

Accession

Q15303-1 (R676-V1308)

Gene ID

2066

Protein Length

Cytoplasmic Domain

Synonyms
ERBB4; v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian); Her4; c-erbB-4
AA Sequence

RRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV

Purity

≥ 70%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

HER4 Protein, Human (sf9, GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
HER4 Protein, Human (sf9, GST)
Cat. No.:
HY-P702752
Quantity:
MCE Japan Authorized Agent: