FABP3 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

FABP3 Protein, Human (His) is a recombinant FABP3 protein with a His-flag. FABP3 Protein is expressed in the skeletal muscle, heart, brain and brown adipose tissue.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • References
  • Help & FAQs

Biological Activity

Description

FABP3 Protein, Human (His) is a recombinant FABP3 protein with a His-flag. FABP3 Protein is expressed in the skeletal muscle, heart, brain and brown adipose tissue[1].

Background

Fatty acid binding proteins (FABPs) are intracellular proteins and exhibit high affinity for small lipophilic ligands. FABP-3 is expressed in the skeletal muscle, heart, brain and brown adipose tissue. And its expression in skeletal muscles is elevated on consumption of a high fat diet. The gene encoding it is localized on human chromosome 1p35.
FABP3 is a newly introduced plasma marker of acute myocardial infarction (AMI). FABP3 is identified as a novel selective autophagy substrate of OPTN (optineurin, a macroautophagy/autophagy receptor, is found to play a pivotal role in selective autophagy, coupling autophagy with bone metabolism). FABP3 promotes adipogenesis and inhibits osteogenesis of MSCs. Knockdown of FABP3 alleviates bone loss in optn-/ - mice and aged mice[1][2].

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • FABP3 (V2-A133)
      Accession # P05413
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    FABP3; Heart-Type Fatty Acid-Binding Protein; Prev. FABP11; Muscle Fatty Acid-Binding Protein; Prev. MDGI; Fatty Acid Binding Protein 11; H-FABP; M-FABP; Mammary-Derived Growth Inhibitor; Fatty Acid Binding Protein 3, Muscle And Heart (Mammary-Derived Gro

  • AA Sequence

    VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

  • Predicted Molecular Mass

    17 kDa

  • Molecular Weight

    Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 6.5.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 5% trehalose, 5% mannitol, 0.02% Tween 80, pH 6.0.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

References

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00