1. Recombinant Proteins
  2. FABP3 Protein, Human (His)

FABP3 Protein, Human (His)

Cat. No.: HY-P70256
Handling Instructions

FABP3 Protein, Human (His) is a recombinant FABP3 protein with a His-flag. FABP3 Protein is expressed in the skeletal muscle, heart, brain and brown adipose tissue[1].

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock
10 μg $120 Ask For Quote & Lead Time
50 μg $360 Ask For Quote & Lead Time

* Please select Quantity before adding items.

  • Technical Parameters

  • Properties

  • Documentation

Synonyms
rHuFatty acid-binding protein/FABP3, His; Fatty Acid-Binding Protein Heart; Fatty Acid-Binding Protein 3; Heart-Type Fatty Acid-Binding Protein; H-FABP; Mammary-Derived Growth Inhibitor; MDGIMuscle Fatty Acid-Binding Protein; M-FABP; FABP3; FABP11; MDGI
Species

Human

Source

E. coli

Accession

P05413 (V2-A133)

Gene ID

2170

Molecular Weight

Approximately 15.0 kDa

AA Sequence

VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Fatty acid binding proteins (FABPs) are intracellular proteins and exhibit high affinity for small lipophilic ligands. FABP-3 is expressed in the skeletal muscle, heart, brain and brown adipose tissue. And its expression in skeletal muscles is elevated on consumption of a high fat diet. The gene encoding it is localized on human chromosome 1p35.
FABP3 is a newly introduced plasma marker of acute myocardial infarction (AMI). FABP3 is identified as a novel selective autophagy substrate of OPTN (optineurin, a macroautophagy/autophagy receptor, is found to play a pivotal role in selective autophagy, coupling autophagy with bone metabolism). FABP3 promotes adipogenesis and inhibits osteogenesis of MSCs. Knockdown of FABP3 alleviates bone loss in optn-/ - mice and aged mice[1][2].

Documentation
References
  • Molarity Calculator

  • Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass   Concentration   Volume   Molecular Weight *
= × ×

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FABP3 Protein, Human (His)
Cat. No.:
HY-P70256
Quantity:
MCE Japan Authorized Agent: