FGF-12 Protein, Human (177 a.a)
Based on 1 Customer Validation
FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.
Background
Fibroblast growth factors (FGFs) play important roles in embryogenesis, angiogenesis, and wound repair, and the FGF family is currently composed of 22 members in humans. FGF12, initially designated as FGF homologous factor 1 (FHF1), is identified by its sequence homology to known FGFs, and it has a high degree of homology with FGF11 (FHF2), FGF12 (FHF3), and FGF14 (FHF4), with a 58–71% amino acid sequence identity with these FGF11 subfamily members. FGF12 has structural similarity with FGF1 and FGF2, in that it lacks a classical signal sequence and contains a nuclear localization signal (NLS), resulting in the accumulation of FGF12 in the nucleus without any release from cells. FGF12 has two forms, a long form (FGF12A) and a short form (FGF12B). FGF12B lacks the NLS because the N-terminal 66 amino acid residues of FGF12A are substituted by 4 amino acids by means of alternative splicing. FGF12 can play a role in tissues by translocating into cells through the plasma membrane, and the availability of this novel CPP provides a new tool for the intracellular delivery of bioactive molecules[1].
Verified Bioactivity
1. The ED50 is <20 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >5 × 104 units/mg.
2. Immobilized Human FGF-12 at 2.0 μg/ml (100 μl/well) can bind Human FGFR3-Fc. The ED50 of Human FGF-12 is 0.5-4.0 μg/ml.
3. Measured in a cell proliferation assay using NIH-3T3 mouse fibroblast cells. The ED50 this effect is 9.139 ng/mL, corresponding to a specific activity is 1.094×10^5 U/mg.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
P61328-1 (E67-T243)
-
Molecular Construction
-
N-term
-
FGF-12 (E67-T243)
Accession # P61328-1 -
C-term
-
-
Protein Length
Partial
-
Synonyms
FGF12; Fibroblast Growth Factor 12B; Prev. FGF12B; EIEE47; FHF1; FGF-12; Fibroblast Growth Factor Homologous Factor 1; DEE47; Myocyte-Activating Factor; FHF-1; Fibroblast Growth Factor FGF-12b; FGF; Fibroblast Growth Factor 12; Fibroblast Growth Factor
-
AA Sequence
EPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
-
Predicted Molecular Mass
20 kDa
-
Molecular Weight
Approximately 21 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
1.Lyophilized from a 0.22 μm filtered solution of PBS.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (263 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
References
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)