1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF family
  4. FGF
  5. FGF-12 Protein, Human (177 a.a)

FGF-12 Protein, Human (177 a.a)

Cat. No.: HY-P7343
Handling Instructions

FGF-12 Protein, Human (177 a.a) is a single polypeptide chain with a molecular mass of 20.4 kDa. FGF12 can play a role in tissues by translocating into cells through the plasma membrane.

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Price Stock Quantity
10 μg $160 In-stock
Estimated Time of Arrival: December 31
50 μg $390 In-stock
Estimated Time of Arrival: December 31
100 μg   Get quote  
250 μg   Get quote  

* Please select Quantity before adding items.

FGF-12 Protein, Human (177 a.a) Featured Recommendations:

Top Publications Citing Use of Products

FGF-12 Protein, Human (177 a.a) Related Classifications

  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

Tag Free

Accession

P61328 (E67-T243)

Gene ID

2257

Synonyms
rHuFGF-12; FHF1; FGF12B
AA Sequence

MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

Molecular Weight

Approximately 20.4 kDa

Biological Activity
The ED50 is <20 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >5 × 104 units/mg.
Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS.

Endotoxin Level

<0.2 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O or PBS.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Background

Fibroblast growth factors (FGFs) play important roles in embryogenesis, angiogenesis, and wound repair, and the FGF family is currently composed of 22 members in humans. FGF12, initially designated as FGF homologous factor 1 (FHF1), is identified by its sequence homology to known FGFs, and it has a high degree of homology with FGF11 (FHF2), FGF12 (FHF3), and FGF14 (FHF4), with a 58–71% amino acid sequence identity with these FGF11 subfamily members. FGF12 has structural similarity with FGF1 and FGF2, in that it lacks a classical signal sequence and contains a nuclear localization signal (NLS), resulting in the accumulation of FGF12 in the nucleus without any release from cells. FGF12 has two forms, a long form (FGF12A) and a short form (FGF12B). FGF12B lacks the NLS because the N-terminal 66 amino acid residues of FGF12A are substituted by 4 amino acids by means of alternative splicing. FGF12 can play a role in tissues by translocating into cells through the plasma membrane, and the availability of this novel CPP provides a new tool for the intracellular delivery of bioactive molecules[1].

Documentation
References
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
FGF-12 Protein, Human (177 a.a)
Cat. No.:
HY-P7343
Quantity:
MCE Japan Authorized Agent: