Copy Link Print Information

FGL1 Protein, Mouse (HEK293, hFc)

Customer Review

Based on 1 Customer Validation

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for FGL1 Protein, Mouse (HEK293, hFc)
  • Experimental Validation Results for FGL1 Protein, Mouse (HEK293, hFc)
  • FGL1 Protein, Mouse (HEK293, hFc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

The FGL1 protein has signaling receptor binding activity and negatively regulates T cell activation and immune response. It is involved in adipose tissue development, cholesterol metabolism, and response to stilbenoid. FGL1 is located in the extracellular region and is orthologous to the human FGL1 gene. It is primarily expressed in the liver at the E18 stage. FGL1 Protein, Mouse (HEK293, hFc) is the recombinant mouse-derived FGL1 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The FGL1 protein is predicted to have signaling receptor binding activity and is involved in the negative regulation of T cell activation and immune response. It plays a role upstream or within various processes, including adipose tissue development, cholesterol metabolic process, and response to stilbenoid. The protein is located in the extracellular region and is orthologous to the human FGL1 (fibrinogen like 1) gene. Additionally, it exhibits restricted expression primarily in the liver at E18 stage.

Verified Bioactivity

Immobilized Mouse LAG-3, hFc Tag (HY-P73843) at 5 μg/mL (100 μL/well) can bind Mouse FGL1. The ED50 for this effect is 0.5343 μg/mL, corresponding to a specific activity is 1.87×103 Unit/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 90%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Immobilized Mouse LAG-3, hFc Tag (HY-P73843) at 5 μg/mL (100 μL/well) can bind Mouse FGL1. The ED50 for this effect is 0.5343 μg/mL, corresponding to a specific activity is 1.87×103 Unit/mg.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag C-hFc
  • Accession

    NP_663569.2 (L23-I314)

  • Gene ID
    234199  [NCBI]
  • Molecular Construction
    • N-term
    • FGL1 (L23-I314)
      Accession # NP_663569.2
    • hFc
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    FGL1; Fibrinogen-Like Protein 1; Fibrinogen Like 1; LFIRE-1; HPS; HFREP1; Hepassocin; HP-041; HFREP-1; Hepatocellular Carcinoma-Related Sequence; Hepatocyte-Derived Fibrinogen-Related Protein 1; LFIRE1; Liver Fibrinogen-Related Protein 1

  • AA Sequence

    LESENCLREQVRLRAQVHQLETRVKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPLQSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNINLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFHPEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAETDNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII

  • Molecular Weight

    Approximately 60-66 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

1.Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 5% trehalose, 5% mannitol, 0.01% tween 80.
2.Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
Please refer to the lot-specific COA for specific buffer information.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 90%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Immobilized Mouse LAG-3, hFc Tag (HY-P73843) at 5 μg/mL (100 μL/well) can bind Mouse FGL1. The ED50 for this effect is 0.5343 μg/mL, corresponding to a specific activity is 1.87×103 Unit/mg.

  • FGL1 Protein, Mouse (HEK293, hFc) Product Image
    1/16
  • Experimental Validation Results for FGL1 Protein, Mouse (HEK293, hFc)
  • Experimental Validation Results for FGL1 Protein, Mouse (HEK293, hFc)
  • FGL1 Protein, Mouse (HEK293, hFc) Product Image