FXN Protein, Rat

Customer Review

Based on 1 Customer Validation

FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.

Background

FXN Protein acts as an activator in the persulfide transfer process within the core iron-sulfur cluster (ISC) assembly complex, essential for [2Fe-2S] cluster assembly. It facilitates sulfur transfer from NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and sulfide release. During [2Fe-2S] cluster assembly, FXN binds ferrous ion and is released upon the addition of L-cysteine and reduced FDX2. The ISC assembly complex, comprising FXN, NFS1, LYRM4, NDUFAB1, and FDX2, initiates de novo synthesis of [2Fe-2S] clusters, transferring them to chaperone proteins like HSCB, HSPA9, and GLRX5. FXN may protect against iron-catalyzed oxidative stress, displaying ferroxidase activity in its oligomeric form. It might function as an iron chaperone, safeguarding aconitase [4Fe-4S]2+ clusters, participating in mitochondrial heme biosynthesis, and modulating the RNA-binding activity of ACO1. Additionally, FXN could contribute to cytoplasmic iron-sulfur protein biogenesis, oxidative stress resistance, and overall cell survival.

Verified Bioactivity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • FXN (L41-T208)
      Accession # D3ZYW7
    • C-term
  • Protein Length

    Full Length of Fxn intermediate form

  • Synonyms

    FXN; CyaY; Prev. FRDA; Friedreich Ataxia Protein; X25; Friedreich Ataxia; Frataxin, Mitochondrial; Fxn; FARR; Frataxin; FA

  • AA Sequence

    LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT

  • Predicted Molecular Mass

    18.6 kDa

  • Molecular Weight

    Approximately 19 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm solution of PBS, 6% trehalose, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00