FXN Protein, Rat
Based on 1 Customer Validation
FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
FXN protein activates persulfide transfer in the ISC assembly complex, promoting sulfur transfer and leading to persulfide and sulfide release. It binds ferrous ions, initiates [2Fe-2S] cluster synthesis, and transfers it to chaperone proteins. FXN Protein, Rat is the recombinant rat-derived FXN protein, expressed by E. coli , with tag free.
FXN Protein acts as an activator in the persulfide transfer process within the core iron-sulfur cluster (ISC) assembly complex, essential for [2Fe-2S] cluster assembly. It facilitates sulfur transfer from NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and sulfide release. During [2Fe-2S] cluster assembly, FXN binds ferrous ion and is released upon the addition of L-cysteine and reduced FDX2. The ISC assembly complex, comprising FXN, NFS1, LYRM4, NDUFAB1, and FDX2, initiates de novo synthesis of [2Fe-2S] clusters, transferring them to chaperone proteins like HSCB, HSPA9, and GLRX5. FXN may protect against iron-catalyzed oxidative stress, displaying ferroxidase activity in its oligomeric form. It might function as an iron chaperone, safeguarding aconitase [4Fe-4S]2+ clusters, participating in mitochondrial heme biosynthesis, and modulating the RNA-binding activity of ACO1. Additionally, FXN could contribute to cytoplasmic iron-sulfur protein biogenesis, oxidative stress resistance, and overall cell survival.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag Tag Free
-
Accession
D3ZYW7 (L41-T208)
-
Molecular Construction
-
N-term
-
FXN (L41-T208)
Accession # D3ZYW7 -
C-term
-
-
Protein Length
Full Length of Fxn intermediate form
-
Synonyms
FXN; CyaY; Prev. FRDA; Friedreich Ataxia Protein; X25; Friedreich Ataxia; Frataxin, Mitochondrial; Fxn; FARR; Frataxin; FA
-
AA Sequence
LHVTANADAIRHSHLNLHYLGQILNIKKQSVCVVHLRNSGTLGNPSSLDETAYERLAEETLDALAEFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPLLYLWFSGPCSGPKRYDWTGKNWVYSHDGVSLHELLARELTEALNTKLDLSSLAYSGKGT
-
Predicted Molecular Mass
18.6 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US;may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)