FXN Protein, Mouse (His)

FXN protein is a key activator in the core iron-sulfur cluster (ISC) assembly complex, accelerating persulfide transfer to ISCU and [2Fe-2S] cluster assembly. It promotes sulfur transfer, leading to oversulfidation and sulfide release. FXN Protein, Mouse (His) is the recombinant mouse-derived FXN protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

FXN protein is a key activator in the core iron-sulfur cluster (ISC) assembly complex, accelerating persulfide transfer to ISCU and [2Fe-2S] cluster assembly. It promotes sulfur transfer, leading to oversulfidation and sulfide release. FXN Protein, Mouse (His) is the recombinant mouse-derived FXN protein, expressed by E. coli , with N-6*His labeled tag.

Background

The FXN protein operates as a pivotal activator within the core iron-sulfur cluster (ISC) assembly complex, orchestrating persulfide transfer to the scaffolding protein ISCU and participating in [2Fe-2S] cluster assembly. FXN accelerates sulfur transfer from the NFS1 persulfide intermediate to ISCU and small thiols like L-cysteine and glutathione, leading to persulfuration and eventual sulfide release. It binds ferrous ion and is released from FXN upon the addition of both L-cysteine and reduced FDX2 during [2Fe-2S] cluster assembly. This ISC assembly complex is integral to de novo synthesis of a [2Fe-2S] cluster, the initial step in mitochondrial iron-sulfur protein biogenesis. The process involves the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1), initiating persulfide production, and FXN-dependent delivery to ISCU. FDX2 stabilizes this complex, providing reducing equivalents for [2Fe-2S] cluster assembly. The cluster is subsequently transferred from ISCU to chaperone proteins, including HSCB, HSPA9, and GLRX5. FXN may play a role in protecting against iron-catalyzed oxidative stress by catalyzing the oxidation of Fe(2+) to Fe(3+), exhibiting ferroxidase activity in its oligomeric form. It potentially acts as an iron chaperone, safeguarding the aconitase [4Fe-4S]2+ cluster, promoting enzyme reactivation, and serving as a high-affinity iron binding partner for FECH, contributing to mitochondrial heme biosynthesis. FXN also modulates the RNA-binding activity of ACO1, may participate in cytoplasmic iron-sulfur protein biogenesis, and could contribute to oxidative stress resistance and overall cell survival.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • FXN (L78-T207)
      Accession # O35943
    • C-term
  • Protein Length

    Full Length of Mature Fxn

  • Synonyms

    FXN; CyaY; Prev. FRDA; Friedreich Ataxia Protein; X25; Friedreich Ataxia; Frataxin, Mitochondrial; Fxn; FARR; Frataxin; FA

  • AA Sequence

    LGTLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLARELTKALNTKLDLSSLAYSGKGT

  • Predicted Molecular Mass

    19.9 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00