1. Recombinant Proteins
  2. Receptor Proteins
  3. GABARAPL2/GATE-16 Protein, Human (His)

GABARAPL2/GATE-16 is an important ubiquitin-like modifier that complexly regulates intra-Golgi flux by coupling NSF activity with SNARE activation. It stimulates the ATPase activity of NSF and promotes binding to GOSR1. GABARAPL2/GATE-16 Protein, Human (His) is the recombinant human-derived GABARAPL2/GATE-16 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GABARAPL2/GATE-16 is an important ubiquitin-like modifier that complexly regulates intra-Golgi flux by coupling NSF activity with SNARE activation. It stimulates the ATPase activity of NSF and promotes binding to GOSR1. GABARAPL2/GATE-16 Protein, Human (His) is the recombinant human-derived GABARAPL2/GATE-16 protein, expressed by E. coli , with N-6*His labeled tag.

Background

GABARAPL2/GATE-16, a ubiquitin-like modifier, intricately participates in intra-Golgi traffic, modulating transport through the coupling of NSF activity and SNAREs activation. It stimulates the ATPase activity of NSF, facilitating its association with GOSR1. Beyond its Golgi-related functions, GABARAPL2/GATE-16 plays a crucial role in autophagy, contributing to mitochondrial quality control by engaging in mitophagy. Unlike LC3s involved in phagophore membrane elongation, the GABARAP/GATE-16 subfamily assumes a pivotal role in the later stages of autophagosome maturation. Operating as a monomer, GABARAPL2/GATE-16 establishes a network of interactions with key autophagy-related proteins such as ATG3, ATG7, ATG13, ULK1, TP53INP1, TP53INP2, TBC1D25, SQSTM1, BNIP3, TECPR2, PCM1, TBC1D5, TRIM5, MEFV, TRIM21, WDFY3, UBA5, GOSR1, KBTBD6, KBTBD7, and others. These interactions emphasize its versatile role in cellular processes, ranging from Golgi dynamics to autophagy and reticulophagy regulation.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

P60520 (M1-F117)

Gene ID
Molecular Construction
N-term
6*His
GABARAPL2 (M1-F117)
Accession # P60520
C-term
Protein Length

Full Length

Synonyms
Gamma-aminobutyric acid receptor-associated protein-like 2; GEF-2; GATE-16; FLC3A
AA Sequence

MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Molecular Weight

Approximately 15 kDa, based on SDS-PAGE under reducing conditions.

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, pH 7.4, 5% trehalose,5% mannitol and 0.01% Tween80 .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GABARAPL2/GATE-16 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GABARAPL2/GATE-16 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GABARAPL2/GATE-16 Protein, Human (His)
Cat. No.:
HY-P76353
Quantity:
MCE Japan Authorized Agent: