GABARAPL2/GATE-16 Protein, Human (His)
Based on 1 Customer Validation
GABARAPL2/GATE-16 is an important ubiquitin-like modifier that complexly regulates intra-Golgi flux by coupling NSF activity with SNARE activation. It stimulates the ATPase activity of NSF and promotes binding to GOSR1. GABARAPL2/GATE-16 Protein, Human (His) is the recombinant human-derived GABARAPL2/GATE-16 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GABARAPL2/GATE-16 is an important ubiquitin-like modifier that complexly regulates intra-Golgi flux by coupling NSF activity with SNARE activation. It stimulates the ATPase activity of NSF and promotes binding to GOSR1. GABARAPL2/GATE-16 Protein, Human (His) is the recombinant human-derived GABARAPL2/GATE-16 protein, expressed by E. coli , with N-6*His labeled tag.
Background
GABARAPL2/GATE-16, a ubiquitin-like modifier, intricately participates in intra-Golgi traffic, modulating transport through the coupling of NSF activity and SNAREs activation. It stimulates the ATPase activity of NSF, facilitating its association with GOSR1. Beyond its Golgi-related functions, GABARAPL2/GATE-16 plays a crucial role in autophagy, contributing to mitochondrial quality control by engaging in mitophagy. Unlike LC3s involved in phagophore membrane elongation, the GABARAP/GATE-16 subfamily assumes a pivotal role in the later stages of autophagosome maturation. Operating as a monomer, GABARAPL2/GATE-16 establishes a network of interactions with key autophagy-related proteins such as ATG3, ATG7, ATG13, ULK1, TP53INP1, TP53INP2, TBC1D25, SQSTM1, BNIP3, TECPR2, PCM1, TBC1D5, TRIM5, MEFV, TRIM21, WDFY3, UBA5, GOSR1, KBTBD6, KBTBD7, and others. These interactions emphasize its versatile role in cellular processes, ranging from Golgi dynamics to autophagy and reticulophagy regulation.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
P60520 (M1-F117)
-
Molecular Construction
-
N-term
-
6*His
-
GABARAPL2 (M1-F117)
Accession # P60520 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GABARAPL2; Golgi-Associated ATPase Enhancer Of 16 KDa; GABA Type A Receptor Associated Protein Like 2; General Protein Transport Factor P16; GATE-16; Ganglioside Expression Factor 2; GEF2; GEF-2; GATE16; GABA(A) Receptor-Associated Protein-Like 2, Isoform
-
AA Sequence
MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 300 mM NaCl, pH 7.4, 5% trehalose,5% mannitol and 0.01% Tween80 .
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
