GDF-15 Protein, Human (Biotinylated, His-Avi)
The GDF-15 protein is critical for regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. It binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem. GDF-15 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived GDF-15 protein, expressed by E. coli , with C-Avi, N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The GDF-15 protein is critical for regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. It binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem. GDF-15 Protein, Human (Biotinylated, His-Avi) is the recombinant human-derived GDF-15 protein, expressed by E. coli , with C-Avi, N-His labeled tag.
Background
GDF-15 Protein plays a pivotal role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It exerts its effects by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons in the parabrachial nucleus and central amygdala, forming part of the 'emergency circuit' involved in shaping feeding responses during stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes. It exists as a homodimer and interacts with GFRAL, acting as a ligand that mediates GDF15 internalization and cellular signaling through interaction with RET.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-Avi;N-8*His
-
Accession
Q99988 (A197-I308)
-
Molecular Construction
-
N-term
-
8*His-Avi
-
GDF-15 (A197-I308)
Accession # Q99988 -
C-term
-
-
Protein Length
Full Length of Growth/differentiation factor 15 Chain
-
Conjugation
Biotin
-
Synonyms
GDF15; Placental Bone Morphogenetic Protein; Growth Differentiation Factor 15; Macrophage Inhibitory Cytokine 1; MIC-1; NSAID-Activated Gene 1 Protein; NAG-1; NSAID-Regulated Gene 1 Protein; PTGFB; Placental TGF-Beta; PLAB; GDF-15; MIC1; NRG-1; PDF; NSAID
-
AA Sequence
ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
-
Predicted Molecular Mass
15.2 kDa
-
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in 50mM HAc, pH 2.9.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
