1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. TGF-beta Superfamily Neurotrophic Factors
  4. Growth Differentiation Factor GDNF family
  5. Growth Differentiation Factor 15 (GDF-15)
  6. GDF-15 Protein, Human (His)

The GDF-15 protein is critical for regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. It binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem. GDF-15 Protein, Human (His) is the recombinant human-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The GDF-15 protein is critical for regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. It binds to its receptor GFRAL and activates GFRAL-expressing neurons in the brainstem. GDF-15 Protein, Human (His) is the recombinant human-derived GDF-15 protein, expressed by E. coli, with N-His labeled tag.

Background

GDF-15 Protein plays a pivotal role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It exerts its effects by binding to its receptor, GFRAL, and activating GFRAL-expressing neurons in the area postrema and nucleus tractus solitarius of the brainstem. This activation subsequently triggers the activation of neurons in the parabrachial nucleus and central amygdala, forming part of the 'emergency circuit' involved in shaping feeding responses during stressful conditions. Additionally, GDF-15 Protein inhibits growth hormone signaling on hepatocytes. It exists as a homodimer and interacts with GFRAL, acting as a ligand that mediates GDF15 internalization and cellular signaling through interaction with RET.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q99988 (A197-I308)

Gene ID

9518

Molecular Construction
N-term
His
GDF-15 (A197-I308)
Accession # Q99988
C-term
Protein Length

Full Length of Growth/differentiation factor 15

Synonyms
Growth/differentiation factor 15; MIC-1; NAG-1; NRG-1; PTGFB
AA Sequence

ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Predicted Molecular Mass
14.3 kDa
Molecular Weight

Approximately 15 kDa under reduced (R) conditions, 27 kDa under non reducing (N) conditions, based on SDS-PAGE.

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from 0.22 μm filtered solution of 30% ACN, 0.085% TFA with trehalose as protectant.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GDF-15 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-15 Protein, Human (His)
Cat. No.:
HY-P704628
Quantity:
MCE Japan Authorized Agent: