GDF-5 Protein, Mouse
Based on 1 Customer Validation
GDF-5 protein is critical in bone and cartilage formation and promotes chondrogenic differentiation through dual pathways. It activates SMAD protein signaling and actively regulates chondrogenesis through high-affinity binding to BMPR1B and low-affinity binding to BMPR1A. GDF-5 Protein, Mouse is the recombinant mouse-derived GDF-5 protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
GDF-5 protein is critical in bone and cartilage formation and promotes chondrogenic differentiation through dual pathways. It activates SMAD protein signaling and actively regulates chondrogenesis through high-affinity binding to BMPR1B and low-affinity binding to BMPR1A. GDF-5 Protein, Mouse is the recombinant mouse-derived GDF-5 protein, expressed by E. coli , with tag free.
Background
GDF-5 Protein plays a crucial role in bone and cartilage formation, orchestrating differentiation in chondrogenic tissue through dual pathways. It positively regulates chondrogenic differentiation by binding with high affinity to BMPR1B and with lower affinity to BMPR1A, triggering the phosphorylation of the SMAD1-SMAD5-SMAD8 complex and subsequent SMAD protein signaling transduction. Simultaneously, it exerts a negative regulatory effect on chondrogenic differentiation through interaction with NOG. Additionally, GDF-5 is essential for preventing excessive muscle loss upon denervation, a function mediated by phosphorylated SMAD1/5/8. The protein also binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Structurally, GDF-5 forms homodimers linked by disulfide bonds and interacts with serine proteases HTRA1 and HTRA3. It may also form a complex with CXCR4, HSP90AA1, and HSPA8 following LPS binding. Furthermore, GDF-5 interacts with high affinity with NOG to inhibit chondrogenesis and with BMPR1B and BMPR1A to positively regulate chondrocyte differentiation through SMAD-dependent signaling. Additionally, it engages in interactions with FBN1 and FBN2.
Verified Bioactivity
Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.2-1.2 µg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - Cell-Based Assay
Bioactivity - Cell-Based Assay
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P43027 (A376-R495)
-
Molecular Construction
-
N-term
-
GDF-5 (A376-R495)
Accession # P43027 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
GDF5; LAP-4; Growth Differentiation Factor 5; Cartilage-Derived Morphogenetic Protein 1; CDMP1; GDF5 Protein; BMP14; DUPANS; Growth/Differentiation Factor 5; CDMP-1; Bone Morphogenetic Protein 14; BDA1C; Cartilage-Derived Morphogenetic Protein-1; SYM1B; L
-
AA Sequence
APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
-
Predicted Molecular Mass
13.6 kDa
-
Molecular Weight
Approximately 16 kDa, based on SDS-PAGE under reducing conditions.
-
Structure/Form
Disulfide-linked homodimer
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 4 mM HCl, pH 2.5.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)