GDF-5 Protein, Mouse

Customer Review

Based on 1 Customer Validation

GDF-5 protein is critical in bone and cartilage formation and promotes chondrogenic differentiation through dual pathways. It activates SMAD protein signaling and actively regulates chondrogenesis through high-affinity binding to BMPR1B and low-affinity binding to BMPR1A. GDF-5 Protein, Mouse is the recombinant mouse-derived GDF-5 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GDF-5 protein is critical in bone and cartilage formation and promotes chondrogenic differentiation through dual pathways. It activates SMAD protein signaling and actively regulates chondrogenesis through high-affinity binding to BMPR1B and low-affinity binding to BMPR1A. GDF-5 Protein, Mouse is the recombinant mouse-derived GDF-5 protein, expressed by E. coli , with tag free.

Background

GDF-5 Protein plays a crucial role in bone and cartilage formation, orchestrating differentiation in chondrogenic tissue through dual pathways. It positively regulates chondrogenic differentiation by binding with high affinity to BMPR1B and with lower affinity to BMPR1A, triggering the phosphorylation of the SMAD1-SMAD5-SMAD8 complex and subsequent SMAD protein signaling transduction. Simultaneously, it exerts a negative regulatory effect on chondrogenic differentiation through interaction with NOG. Additionally, GDF-5 is essential for preventing excessive muscle loss upon denervation, a function mediated by phosphorylated SMAD1/5/8. The protein also binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Structurally, GDF-5 forms homodimers linked by disulfide bonds and interacts with serine proteases HTRA1 and HTRA3. It may also form a complex with CXCR4, HSP90AA1, and HSPA8 following LPS binding. Furthermore, GDF-5 interacts with high affinity with NOG to inhibit chondrogenesis and with BMPR1B and BMPR1A to positively regulate chondrocyte differentiation through SMAD-dependent signaling. Additionally, it engages in interactions with FBN1 and FBN2.

Verified Bioactivity

Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.2-1.2 µg/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.4147 µg/mL, corresponding to a specific activity is 2.411×10^3 units/mg.

Technical Parameters

  • Species Mouse
  • Source E. coli
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GDF-5 (A376-R495)
      Accession # P43027
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    GDF5; LAP-4; Growth Differentiation Factor 5; Cartilage-Derived Morphogenetic Protein 1; CDMP1; GDF5 Protein; BMP14; DUPANS; Growth/Differentiation Factor 5; CDMP-1; Bone Morphogenetic Protein 14; BDA1C; Cartilage-Derived Morphogenetic Protein-1; SYM1B; L

  • AA Sequence

    APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

  • Predicted Molecular Mass

    13.6 kDa

  • Molecular Weight

    Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

  • Structure/Form

    Disulfide-linked homodimer

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00