1. Recombinant Proteins
  2. Others
  3. GDF-5 Protein, Mouse

GDF-5 protein is critical in bone and cartilage formation and promotes chondrogenic differentiation through dual pathways. It activates SMAD protein signaling and actively regulates chondrogenesis through high-affinity binding to BMPR1B and low-affinity binding to BMPR1A. GDF-5 Protein, Mouse is the recombinant mouse-derived GDF-5 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GDF-5 protein is critical in bone and cartilage formation and promotes chondrogenic differentiation through dual pathways. It activates SMAD protein signaling and actively regulates chondrogenesis through high-affinity binding to BMPR1B and low-affinity binding to BMPR1A. GDF-5 Protein, Mouse is the recombinant mouse-derived GDF-5 protein, expressed by E. coli , with tag free.

Background

GDF-5 Protein plays a crucial role in bone and cartilage formation, orchestrating differentiation in chondrogenic tissue through dual pathways. It positively regulates chondrogenic differentiation by binding with high affinity to BMPR1B and with lower affinity to BMPR1A, triggering the phosphorylation of the SMAD1-SMAD5-SMAD8 complex and subsequent SMAD protein signaling transduction. Simultaneously, it exerts a negative regulatory effect on chondrogenic differentiation through interaction with NOG. Additionally, GDF-5 is essential for preventing excessive muscle loss upon denervation, a function mediated by phosphorylated SMAD1/5/8. The protein also binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Structurally, GDF-5 forms homodimers linked by disulfide bonds and interacts with serine proteases HTRA1 and HTRA3. It may also form a complex with CXCR4, HSP90AA1, and HSPA8 following LPS binding. Furthermore, GDF-5 interacts with high affinity with NOG to inhibit chondrogenesis and with BMPR1B and BMPR1A to positively regulate chondrocyte differentiation through SMAD-dependent signaling. Additionally, it engages in interactions with FBN1 and FBN2.

Biological Activity

Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.2-1.2 µg/mL.

  • Measured by its ability to induce alkaline phosphatase production by ATDC5 mouse chondrogenic cells. The ED50 for this effect is 0.4147 µg/mL, corresponding to a specific activity is 2.411×10^3 units/mg.
Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P43027 (A376-R495)

Gene ID
Molecular Construction
N-term
GDF-5 (A376-R495)
Accession # P43027
C-term
Protein Length

Full Length of Growth/differentiation factor 5

Synonyms
Growth/differentiation factor 5; Gdf5; GDF-5; Bone morphogenetic protein 14; BMP-14; Bmp14; Bp; Growth Differentiation Factor 5
AA Sequence

APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR

Predicted Molecular Mass
13.6 kDa
Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Structure/Form
Disulfide-linked homodimer
Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of 4 mM HCl, pH 2.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GDF-5 Protein, Mouse Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GDF-5 Protein, Mouse

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GDF-5 Protein, Mouse
Cat. No.:
HY-P79332
Quantity:
MCE Japan Authorized Agent: