GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution)

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution) is the recombinant rat/mouse/human-derived GDF-8 protein, expressed by HEK293, with C-Avi labeled tag.

GDF-8 (Growth Differentiation Factor 8) serves as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and interacts with WFIKKN2, thereby inhibiting the activity of the latter. Additionally, GDF-8 interacts with FST3, contributing to its regulatory role in modulating skeletal muscle growth.

1. Immobilized Human/Cynomolgus Activin RIIA, His Tag at 1μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human/Mouse/Rat GDF-8, Avi Tag with the EC₅₀ of ≤10.8ng/ml determined by ELISA.
2. Immobilized Human/Cynomolgus Activin RIIB, His Tag at 1μg/ml (100μl/well) on the plate. Dose response curve for Biotinylated Human/Mouse/Rat GDF-8, Avi Tag with the EC₅₀ of 2.5ng/ml determined by ELISA.

Rat; Human; Mouse

HEK293

C-Avi

O14793 (D267-S375)

2660

Partial

Biotin

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

≥ 95%, as determined by Bis-Tris PAGE.

Solution.

Supplied as a 0.22 μm filtered solution of 4 mM HCl.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.