GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution)
Based on 1 Customer Validation
GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution) is the recombinant rat/mouse/human-derived GDF-8 protein, expressed by HEK293, with C-Avi labeled tag.
- Species: Rat; Human; Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution) is the recombinant rat/mouse/human-derived GDF-8 protein, expressed by HEK293, with C-Avi labeled tag.
Background
GDF-8 (Growth Differentiation Factor 8) serves as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and interacts with WFIKKN2, thereby inhibiting the activity of the latter. Additionally, GDF-8 interacts with FST3, contributing to its regulatory role in modulating skeletal muscle growth.
Verified Bioactivity
1. Immobilized Human/Cynomolgus Activin RIIA, His Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human/Mouse/Rat GDF-8, Avi Tag with the EC50 of ≤10.8 ng/mL determined by ELISA.
2. Immobilized Human/Cynomolgus Activin RIIB, His Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human/Mouse/Rat GDF-8, Avi Tag with the EC50 of 1.0-10.0 ng/mL determined by ELISA.
Technical Parameters
-
Species Rat; Human; Mouse
-
Source HEK293
-
Tag C-Avi
-
Accession
O14793 (D267-S375)
-
Gene ID2660
-
Molecular Construction
-
N-term
-
GDF-8 (D267-S375)
Accession # O14793 -
Avi
-
C-term
-
-
Protein Length
Full Length of Growth/differentiation factor 8 Chain
-
Conjugation
Biotin
-
Synonyms
MSTN; GDF-8; Prev. GDF8; Myostatin-B; Growth/Differentiation Factor 8; MSLHP; Myostatin; Growth Differentiation Factor 8
-
AA Sequence
DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
-
Predicted Molecular Mass
14.2 kDa
-
Molecular Weight
Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Structure/Form
Monomer
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 4 mM HCl.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
