GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution)

Customer Review

Based on 1 Customer Validation

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution) is the recombinant rat/mouse/human-derived GDF-8 protein, expressed by HEK293, with C-Avi labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat; Human; Mouse
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

GDF-8 (Growth Differentiation Factor 8) functions as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and inhibits WFIKKN2 activity through interaction. GDF-8 also interacts with FST3, playing a regulatory role in skeletal muscle growth modulation. GDF-8 Protein, Human/Mouse/Rat (Biotinylated, 109a.a, HEK293, Avi, Solution) is the recombinant rat/mouse/human-derived GDF-8 protein, expressed by HEK293, with C-Avi labeled tag.

Background

GDF-8 (Growth Differentiation Factor 8) serves as a specific negative regulator of skeletal muscle growth. It forms homodimers linked by disulfide bonds and interacts with WFIKKN2, thereby inhibiting the activity of the latter. Additionally, GDF-8 interacts with FST3, contributing to its regulatory role in modulating skeletal muscle growth.

Verified Bioactivity

1. Immobilized Human/Cynomolgus Activin RIIA, His Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human/Mouse/Rat GDF-8, Avi Tag with the EC50 of ≤10.8 ng/mL determined by ELISA.
2. Immobilized Human/Cynomolgus Activin RIIB, His Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Biotinylated Human/Mouse/Rat GDF-8, Avi Tag with the EC50 of 1.0-10.0 ng/mL determined by ELISA.

Technical Parameters

  • Species Rat; Human; Mouse
  • Source HEK293
  • Tag C-Avi
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GDF-8 (D267-S375)
      Accession # O14793
    • Avi
    • C-term
  • Protein Length

    Full Length of Growth/differentiation factor 8 Chain

  • Conjugation

    Biotin

  • Synonyms

    MSTN; GDF-8; Prev. GDF8; Myostatin-B; Growth/Differentiation Factor 8; MSLHP; Myostatin; Growth Differentiation Factor 8

  • AA Sequence

    DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

  • Predicted Molecular Mass

    14.2 kDa

  • Molecular Weight

    Approximately 15-18 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Structure/Form

    Monomer

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Solution

Formulation

Supplied as a 0.22 μm filtered solution of 4 mM HCl.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00