GFRAL Protein, Human (HEK293, His-Avi)
Based on 1 Customer Validation
The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The GFRAL protein is a brainstem-restricted receptor for GDF15 that regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stress. GFRAL binds to its ligand GDF15, interacts with RET, and activates the MAPK and AKT signaling pathways. GFRAL Protein, Human (HEK293, His-Avi) is the recombinant human-derived GFRAL protein, expressed by HEK293 , with C-Avi, C-His labeled tag.
Background
GFRAL Protein, a brainstem-restricted receptor for GDF15, plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding to its ligand, GDF15, GFRAL interacts with RET and activates cellular signaling through the MAPK- and AKT-signaling pathways. The receptor, through its extracellular domain, forms complexes with both GDF15 and RET, mediating cellular signaling specifically when RET is engaged after GDF15 binding. This intricate interaction highlights the sequential steps involving GFRAL, GDF15, and RET in the modulation of physiological responses to metabolic challenges.
Verified Bioactivity
1.Immobilized Human GFRAL, His Tag at 0.5 μg/mL (100 μL/Well). Dose response curve for Human GDF15, hFc Tag with the EC50 of 5.0-15.0 ng/mL determined by ELISA.
2.Immobilized Human GFRAL, His Tag at 1 μg/mL (100 μL/well) on the plate. Dose response curve for Human GDF15, hFc Tag with the EC50 of 1.0-10.0 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Avi;C-8*His
-
Accession
Q6UXV0 (S19-E351)
-
Molecular Construction
-
N-term
-
GFRAL (S19-E351)
Accession # Q6UXV0 -
8*His-Avi
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GFRAL; GRAL; Prev. C6orf144; Chromosome 6 Open Reading Frame 144; BA360D14.1; IVFI9356; UNQ9356; GDNF Family Receptor Alpha Like; GDNF Family Receptor Alpha-Like
-
AA Sequence
SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE
-
Predicted Molecular Mass
40.7 kDa
-
Molecular Weight
Approximately 48-62 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)