Copy Link Print Information

GFRAL Protein, Mouse (Biotinylated, HEK293, His-Avi)

Customer Review

Based on 1 Customer Validation

GFRAL protein, a brainstem-restricted receptor, regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds with GDF15, interacts with RET, and activates MAPK- and AKT- signaling pathways. GFRAL acts as a receptor for GDF15 and mediates cellular signaling through RET, requiring prior GDF15 binding. GFRAL Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived GFRAL protein, expressed by HEK293 , with C-Avi, N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Mouse
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • GFRAL Protein, Mouse (Biotinylated, HEK293, His-Avi) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

GFRAL protein, a brainstem-restricted receptor, regulates food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. It binds with GDF15, interacts with RET, and activates MAPK- and AKT- signaling pathways. GFRAL acts as a receptor for GDF15 and mediates cellular signaling through RET, requiring prior GDF15 binding. GFRAL Protein, Mouse (Biotinylated, HEK293, His-Avi) is the recombinant mouse-derived GFRAL protein, expressed by HEK293 , with C-Avi, N-His labeled tag.

Background

GFRAL protein is a brainstem-restricted receptor that plays a crucial role in regulating food intake, energy expenditure, and body weight in response to metabolic and toxin-induced stresses. Upon binding with its ligand, GDF15, GFRAL interacts with RET and activates MAPK- and AKT- signaling pathways. GFRAL interacts with GDF15 and RET through its extracellular domain, acting as a receptor for GDF15 and mediating cellular signaling through the interaction with RET after GDF15 binding. It is important to note that the interaction with RET requires previous GDF15 binding.

Verified Bioactivity

Immobilized Biotinylated Mouse GFRAL, His Tag at 0.5μg/ml (100μl/Well) on streptavidin (5μg/ml) precoated plate. Dose response curve for Mouse GDF15, hFc Tag with the EC50 of 2.4ng/ml determined by ELISA.

Technical Parameters

  • Species Mouse
  • Source HEK293
  • Tag N-Avi;N-8*His
  • Accession

    Q6SJE0-1 (Q20-E350)

  • Gene ID
    404194  [NCBI]
  • Molecular Construction
    • N-term
    • 8*His-Avi
    • GFRAL (Q20-E350)
      Accession # Q6SJE0-1
    • C-term
  • Protein Length

    Extracellular Domain

  • Conjugation

    Biotin

  • Synonyms

    GFRAL; GRAL; Prev. C6orf144; Chromosome 6 Open Reading Frame 144; BA360D14.1; IVFI9356; UNQ9356; GDNF Family Receptor Alpha Like; GDNF Family Receptor Alpha-Like

  • AA Sequence

    QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNGE

  • Predicted Molecular Mass

    40.1 kDa

  • Molecular Weight

    Approximately 48-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 95%, as determined by reducing Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • GFRAL Protein, Mouse (Biotinylated, HEK293, His-Avi) Product Image
    1/16
  • GFRAL Protein, Mouse (Biotinylated, HEK293, His-Avi) Product Image