GLUT3 Protein, Human (sf9, His)
Based on 1 Customer Validation
GLUT3 Protein, Human (sf9, His) is the recombinant human-derived GLUT3, expressed by sf9 insect cells , with His labeled tag. ,
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GLUT3 Protein, Human (sf9, His) is the recombinant human-derived GLUT3, expressed by sf9 insect cells , with His labeled tag. ,
Background
GLUT3 is a facilitative glucose transporter that mediates the uptake of glucose and various other monosaccharides across the cell membrane, including 2-deoxyglucose, galactose, mannose, xylose, and fucose, and likely also dehydroascorbate, but not fructose. By similarity, it is required for mesendoderm differentiation.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-10*His
-
Accession
P11169 (M1-V496, N43T)
-
Gene ID6515
-
Protein Length
Full Length
-
Synonyms
SLC2A3; Solute Carrier Family 2, Facilitated Glucose Transporter Member 3; Prev. GLUT3; GLUT-3; Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 3; Solute Carrier Family 2 Member 3; Glucose Transporter Type 3, Brain
-
AA Sequence
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFITKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV
-
Predicted Molecular Mass
55.3 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 20 mM HEPES, pH 7.5, 150 mM NaCl, 0.002% , w/v LMNG.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
