GMPR Protein, Human (His)
Based on 1 Customer Validation
GMPR protein plays a crucial role in nucleotide metabolism by catalyzing the irreversible NADPH-dependent deamination of to IMP. This enzymatic activity is pivotal for the conversion of nucleobase, nucleoside, and nucleotide derivatives of guanine (G) to adenine (A) nucleotides, contributing to the intricate network of biochemical processes involved in maintaining the essential intracellular balance between A and G nucleotides. GMPR Protein, Human (His) is the recombinant human-derived GMPR protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
GMPR protein plays a crucial role in nucleotide metabolism by catalyzing the irreversible NADPH-dependent deamination of to IMP. This enzymatic activity is pivotal for the conversion of nucleobase, nucleoside, and nucleotide derivatives of guanine (G) to adenine (A) nucleotides, contributing to the intricate network of biochemical processes involved in maintaining the essential intracellular balance between A and G nucleotides. GMPR Protein, Human (His) is the recombinant human-derived GMPR protein, expressed by E. coli , with N-His labeled tag.
GMPR protein plays a crucial role in nucleotide metabolism by catalyzing the irreversible NADPH-dependent deamination of GMP to IMP. This enzymatic activity is pivotal for the conversion of nucleobase, nucleoside, and nucleotide derivatives of guanine (G) to adenine (A) nucleotides, contributing to the intricate network of biochemical processes involved in maintaining the essential intracellular balance between A and G nucleotides.
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
P36959/NP_006868.3 (M1-S345)
-
Molecular Construction
-
N-term
-
His
-
GMPR (M1-S345)
Accession # P36959/NP_006868.3 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
GMPR; HGMPR-I; Guanosine Monophosphate Reductase; GMPR 1; GMPR1; Guanosine 5'-Monophosphate Oxidoreductase; GMP Reductase 1; Guanine Monophosphate Reductase; Guanosine 5'-Monophosphate Oxidoreductase 1; GMP Reductase; Guanosine Monophosphate Reductase 1
-
AA Sequence
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, 40% Glycerol, 1 mM DTT, pH 8.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (237 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
