1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Oxidoreductases (EC 1)
  4. GMPR Protein, Human (His)

GMPR protein plays a crucial role in nucleotide metabolism by catalyzing the irreversible NADPH-dependent deamination of to IMP. This enzymatic activity is pivotal for the conversion of nucleobase, nucleoside, and nucleotide derivatives of guanine (G) to adenine (A) nucleotides, contributing to the intricate network of biochemical processes involved in maintaining the essential intracellular balance between A and G nucleotides. GMPR Protein, Human (His) is the recombinant human-derived GMPR protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

GMPR protein plays a crucial role in nucleotide metabolism by catalyzing the irreversible NADPH-dependent deamination of to IMP. This enzymatic activity is pivotal for the conversion of nucleobase, nucleoside, and nucleotide derivatives of guanine (G) to adenine (A) nucleotides, contributing to the intricate network of biochemical processes involved in maintaining the essential intracellular balance between A and G nucleotides. GMPR Protein, Human (His) is the recombinant human-derived GMPR protein, expressed by E. coli , with N-His labeled tag.

Background

GMPR protein plays a crucial role in nucleotide metabolism by catalyzing the irreversible NADPH-dependent deamination of GMP to IMP. This enzymatic activity is pivotal for the conversion of nucleobase, nucleoside, and nucleotide derivatives of guanine (G) to adenine (A) nucleotides, contributing to the intricate network of biochemical processes involved in maintaining the essential intracellular balance between A and G nucleotides.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Human

Source

E. coli

Tag

N-His

Accession

P36959/NP_006868.3 (M1-S345)

Gene ID
Molecular Construction
N-term
His
GMPR (M1-S345)
Accession # P36959/NP_006868.3
C-term
Protein Length

Full Length

Synonyms
GMP Reductase 1; Guanosine Monophosphate Reductase 1; GMPR; GMPR1
AA Sequence

MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS

Molecular Weight

Approximately 37 kDa

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris, 150 mM NaCl, 40% Glycerol, 1 mM DTT, pH 8.0. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

GMPR Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

GMPR Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
GMPR Protein, Human (His)
Cat. No.:
HY-P75791
Quantity:
MCE Japan Authorized Agent: