GPR37 Protein, Human (HEK293, His)

GPR37 Protein, a receptor for prosaposin, undergoes endocytosis upon ligand binding, initiating an ERK phosphorylation cascade. It forms a complex with PRKN, STUB1, and HSP70, with STUB1 association increasing during ER stress. STUB1 facilitates HSP70 dissociation from PRKN, promoting PRKN-mediated ubiquitination of GPR37. GPR37 also interacts with PACRG, indicating a complex regulatory network in its cellular functions. GPR37 Protein, Human (HEK293, His) is the recombinant human-derived GPR37, expressed by HEK293, with C-His labeled tag.

The GPR37 Protein functions as a receptor for the neuroprotective and glioprotective factor prosaposin. Upon ligand binding, GPR37 undergoes endocytosis, initiating an ERK phosphorylation cascade. This receptor forms a complex with PRKN, STUB1, and HSP70, with the association of STUB1 increasing during ER stress. STUB1 plays a crucial role in facilitating the dissociation of HSP70 from PRKN, promoting PRKN-mediated ubiquitination of GPR37. Additionally, GPR37 interacts with PACRG, suggesting a complex regulatory network involved in its cellular functions.

Human

HEK293

C-10*His

NP_005293.1/O15354 (A27-M265)

2861  [NCBI]

Extracellular Domain

ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM

Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation .

≥ 95%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.