GPR37 Protein, Human (HEK293, His)
GPR37 Protein, a receptor for prosaposin, undergoes endocytosis upon ligand binding, initiating an ERK phosphorylation cascade. It forms a complex with PRKN, STUB1, and HSP70, with STUB1 association increasing during ER stress. STUB1 facilitates HSP70 dissociation from PRKN, promoting PRKN-mediated ubiquitination of GPR37. GPR37 also interacts with PACRG, indicating a complex regulatory network in its cellular functions. GPR37 Protein, Human (HEK293, His) is the recombinant human-derived GPR37, expressed by HEK293, with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GPR37 Protein, a receptor for prosaposin, undergoes endocytosis upon ligand binding, initiating an ERK phosphorylation cascade. It forms a complex with PRKN, STUB1, and HSP70, with STUB1 association increasing during ER stress. STUB1 facilitates HSP70 dissociation from PRKN, promoting PRKN-mediated ubiquitination of GPR37. GPR37 also interacts with PACRG, indicating a complex regulatory network in its cellular functions. GPR37 Protein, Human (HEK293, His) is the recombinant human-derived GPR37, expressed by HEK293, with C-His labeled tag.
Background
The GPR37 Protein functions as a receptor for the neuroprotective and glioprotective factor prosaposin. Upon ligand binding, GPR37 undergoes endocytosis, initiating an ERK phosphorylation cascade. This receptor forms a complex with PRKN, STUB1, and HSP70, with the association of STUB1 increasing during ER stress. STUB1 plays a crucial role in facilitating the dissociation of HSP70 from PRKN, promoting PRKN-mediated ubiquitination of GPR37. Additionally, GPR37 interacts with PACRG, suggesting a complex regulatory network involved in its cellular functions.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-10*His
-
Accession
NP_005293.1/O15354 (A27-M265)
-
Molecular Construction
-
N-term
-
GPR37 (A27-M265)
Accession # NP_005293.1/O15354 -
10*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
GPR37; Endothelin B Receptor-Like Protein 1; G Protein-Coupled Receptor 37; Prosaposin Receptor GPR37; PAELR; ETBR-LP-1; HET(B)R-LP; Probable G-Protein Coupled Receptor 37; EDNRBL; Endothelin Receptor Type B-Like; G Protein-Coupled Receptor 37 (Endothelin
-
AA Sequence
ALGVAPASRNETCLGESCAPTVIQRRGRDAWGPGNSARDVLRARAPREEQGAAFLAGPSWDLPAAPGRDPAAGRGAEASAAGPPGPPTRPPGPWRWKGARGQEPSETLGRGNPTALQLFLQISEEEEKGPRGAGISGRSQEQSVKTVPGASDLFYWPRRAGKLQGSHHKPLSKTANGLAGHEGWTIALPGRALAQNGSLGEGIHEPGGPRRGNSTNRRVRLKNPFYPLTQESYGAYAVM
-
Predicted Molecular Mass
26.6 kDa
-
Molecular Weight
Approximately 30-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
