GPR56 Protein, Human (HEK293, His)
Based on 1 Customer Validation
GPR56, a cell adhesion receptor, mediates cell-matrix adhesion in developing neurons and hematopoietic stem cells. It acts as a receptor for collagen III (COL3A1), influencing cortical development and hematopoietic stem cell maintenance. Additionally, GPR56 plays a pivotal role in cancer progression by inhibiting angiogenesis via PRKCA-mediated signaling and is essential for testis development. GPR56 Protein, Human (HEK293, His) is the recombinant human-derived GPR56 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GPR56, a cell adhesion receptor, mediates cell-matrix adhesion in developing neurons and hematopoietic stem cells. It acts as a receptor for collagen III (COL3A1), influencing cortical development and hematopoietic stem cell maintenance. Additionally, GPR56 plays a pivotal role in cancer progression by inhibiting angiogenesis via PRKCA-mediated signaling and is essential for testis development. GPR56 Protein, Human (HEK293, His) is the recombinant human-derived GPR56 protein, expressed by HEK293 , with C-His labeled tag.
Background
GPR56 Protein functions as a receptor pivotal in cell adhesion and likely involved in cell-cell interactions. It plays a crucial role in mediating cell matrix adhesion during the development of neurons and hematopoietic stem cells. In the developing brain, GPR56 acts as a receptor for collagen III/COL3A1, contributing to the regulation of cortical development and playing a specific role in maintaining pial basement membrane integrity and cortical lamination. The interaction with the COL3A1 ligand inhibits neuronal migration and activates the RhoA pathway through coupling to GNA13 and possibly GNA12. Additionally, GPR56 is implicated in the maintenance of hematopoietic stem cells and/or leukemia stem cells within the bone marrow niche. Notably, GPR56 assumes a critical role in cancer progression, exhibiting a dual function by inhibiting VEGFA production and angiogenesis through a PRKCA-mediated signaling pathway, as well as activating VEGFA production to promote angiogenesis. Moreover, GPR56 proves essential in testis development, highlighting its diverse and significant contributions to various cellular processes.
Verified Bioactivity
Measured by the ability of the immobilized protein to enhance the adhesion of T-98G human glioblastoma cells to human Fibronectin. When 4 x 104 cells/well are added to plates coated with human Fibronectin (0.1 µg/mL, HY-P70593) and rhGPR56 (10 µg/well, 100 µL/well) for 45 minutes at 37°C there is a 1.31 fold increase in adhesion to human fibronectin induced by the presence of rhGPR56.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q9Y653-2/NP_958933.1 (R26-V342)
-
Molecular Construction
-
N-term
-
GPR56 (R26-V342)
Accession # Q9Y653-2/NP_958933.1 -
His
-
C-term
-
-
Protein Length
Partial Extracellular Domain
-
Synonyms
ADGRG1; G-Protein Coupled Receptor 56; Prev. GPR56; Testicular Tissue Protein Li 77; TM7LN4; CDCBM14B; TM7XN1; CDCBM15A; Adhesion G-Protein Coupled Receptor G1; BFPP; G Protein-Coupled Receptor 56; BPPR; Adhesion G Protein-Coupled Receptor G1; 7-Transmemb
-
AA Sequence
RGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAPFPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSVTSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQSLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGRSGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNV
-
Molecular Weight
Approximately 50-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (238 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
