Copy Link Print Information

MFAP4 Protein, Human (HEK293, His-Flag)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

MFAP4 is a protein that may be involved in calcium-dependent cell adhesion or cell-cell interactions and may play a role in elastic fiber assembly and maintenance. It exists as homodimers and is capable of forming higher oligomers. MFAP4 Protein, Human (HEK293, His-Flag) is the recombinant human-derived MFAP4 protein, expressed by HEK293 , with N-His, N-Flag labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • MFAP4 Protein, Human (HEK293, His-Flag) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

MFAP4 is a protein that may be involved in calcium-dependent cell adhesion or cell-cell interactions and may play a role in elastic fiber assembly and maintenance. It exists as homodimers and is capable of forming higher oligomers. MFAP4 Protein, Human (HEK293, His-Flag) is the recombinant human-derived MFAP4 protein, expressed by HEK293 , with N-His, N-Flag labeled tag.

Background

The MFAP4 protein is implicated in potential roles related to calcium-dependent cell adhesion and intercellular interactions. It may contribute to the assembly and maintenance of elastic fibers, as suggested by its interaction with proteins such as FBN1, FBN2, LOX, COL1A1, and ELN. MFAP4 forms homodimers and higher oligomers, and its interaction with collagen type I (COL1A1) occurs in a calcium-dependent manner. Additionally, MFAP4 interacts with elastin (ELN) in a calcium-dependent manner, promoting the self-assembly of ELN. These molecular interactions highlight the versatility of MFAP4 in participating in cellular adhesion, extracellular matrix dynamics, and elastic fiber-related processes.

Verified Bioactivity

Immobilized Human MFAP4, His Tag at 1 or 2 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-MFAP4 Antibody, hFc Tag with the EC50 ≤10.7 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-8*His;N-Flag
  • Accession

    P55083-1 (V22-A255)

  • Gene ID
    4239  [NCBI]
  • Molecular Construction
    • N-term
    • 8*His-Flag
    • MFAP4 (V22-A255)
      Accession # P55083-1
    • C-term
  • Protein Length

    Full Length of Isoform-1

  • Synonyms

    MFAP4; Microfibril-Associated Glycoprotein 4; Microfibril Associated Protein 4; Microfibrillar Associated Protein 4

  • AA Sequence

    VSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

  • Predicted Molecular Mass

    28.6 kDa

  • Molecular Weight

    Approximately 38-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • MFAP4 Protein, Human (HEK293, His-Flag) Product Image
    1/16
  • MFAP4 Protein, Human (HEK293, His-Flag) Product Image