1. Recombinant Proteins
  2. Others
  3. MFAP4 Protein, Human (HEK293, His-Flag)

MFAP4 is a protein that may be involved in calcium-dependent cell adhesion or cell-cell interactions and may play a role in elastic fiber assembly and maintenance. It exists as homodimers and is capable of forming higher oligomers. MFAP4 Protein, Human (HEK293, His-Flag) is the recombinant human-derived MFAP4 protein, expressed by HEK293 , with N-His, N-Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
> 500 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE MFAP4 Protein, Human (HEK293, His-Flag)

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

MFAP4 is a protein that may be involved in calcium-dependent cell adhesion or cell-cell interactions and may play a role in elastic fiber assembly and maintenance. It exists as homodimers and is capable of forming higher oligomers. MFAP4 Protein, Human (HEK293, His-Flag) is the recombinant human-derived MFAP4 protein, expressed by HEK293 , with N-His, N-Flag labeled tag.

Background

The MFAP4 protein is implicated in potential roles related to calcium-dependent cell adhesion and intercellular interactions. It may contribute to the assembly and maintenance of elastic fibers, as suggested by its interaction with proteins such as FBN1, FBN2, LOX, COL1A1, and ELN. MFAP4 forms homodimers and higher oligomers, and its interaction with collagen type I (COL1A1) occurs in a calcium-dependent manner. Additionally, MFAP4 interacts with elastin (ELN) in a calcium-dependent manner, promoting the self-assembly of ELN. These molecular interactions highlight the versatility of MFAP4 in participating in cellular adhesion, extracellular matrix dynamics, and elastic fiber-related processes.

Biological Activity

Immobilized Human MFAP4, His Tag at 1 or 2 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-MFAP4 Antibody, hFc Tag with the EC50 ≤10.7 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

N-8*His;N-Flag

Accession

P55083-1 (V22-A255)

Gene ID
Molecular Construction
N-term
8*His-Flag
MFAP4 (V22-A255)
Accession # P55083-1
C-term
Protein Length

Full Length of Isoform-1 Mature Protein

Synonyms
Microfibril-associated glycoprotein 4; Mfap4
AA Sequence

VSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA

Molecular Weight

35-45 kDa

Glycosylation
Yes
Purity

≥ 90%, as determined by Bis-Tris PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

MFAP4 Protein, Human (HEK293, His-Flag) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

MFAP4 Protein, Human (HEK293, His-Flag)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
MFAP4 Protein, Human (HEK293, His-Flag)
Cat. No.:
HY-P77993
Quantity:
MCE Japan Authorized Agent: