GPT2 Protein, Rat (sf9, His)
Based on 1 Customer Validation
GPT2 protein is predicted by L-alanine:2-oxoglutarate aminotransferase activity and is involved in insulin response, gluconeogenesis, and testosterone response. It is located in the extracellular space and mitochondria, is a biomarker for type 2 diabetes, and is orthologous to human GPT2. GPT2 Protein, Rat (sf9, His) is the recombinant rat-derived GPT2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Rat
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
GPT2 protein is predicted by L-alanine:2-oxoglutarate aminotransferase activity and is involved in insulin response, gluconeogenesis, and testosterone response. It is located in the extracellular space and mitochondria, is a biomarker for type 2 diabetes, and is orthologous to human GPT2. GPT2 Protein, Rat (sf9, His) is the recombinant rat-derived GPT2 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
GPT2 Protein is predicted to enable L-alanine:2-oxoglutarate aminotransferase activity and participates in various processes, including the cellular response to insulin stimulus, positive regulation of gluconeogenesis, and response to testosterone. It is localized in both the extracellular space and mitochondrion. Recognized as a biomarker of type 2 diabetes mellitus, GPT2 is the orthologous counterpart to human GPT2 (glutamic--pyruvic transaminase 2). Notably, the gene displays biased expression, with prominent levels observed in the Adrenal (RPKM 312.5), Liver (RPKM 220.8), and eight other tissues, emphasizing its specific roles in metabolic processes and signaling pathways across various tissues.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Rat
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
NP_001012057.1 (M1-S522)
-
Molecular Construction
-
N-term
-
GPT2 (M1-S522)
Accession # A0A8I6ARL0/NP_001012057.1 -
His
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
GPT2; Glutamic Pyruvate Transaminase (Alanine Aminotransferase) 2; Glutamic--Pyruvic Transaminase 2; Glutamate Pyruvate Transaminase 1; ALT2; Glutamic--Pyruvic Transaminase 1; Alanine Aminotransferase 2; Glutamic--Alanine Transaminase 1; Glutamate Pyruvat
-
AA Sequence
MQRAAVLVRRGSCPRASGPWGRSHSSAAAEASAALKVRPERSPRDRILTLESMNPQVKAVEYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPNLLNSPSFPEDAKKRARRILQ ACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPDNIYLTTGASDGISTILKLLVSGGGKSRTGVMI PIPQYPLYSAVISELDAIQVNYYLDEDNCWALNVDELRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKC IEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYQMGPEYSSNVELASFHSTSKGYMGECGYRG GYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVPGEESFEQFTREKESVLGNLAKKAKLTE DLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPGSGFGQREGTY HFRMTILPPVEKLKTVLHKVKDFHLKFLEKYS
-
Predicted Molecular Mass
55 kDa
-
Molecular Weight
Approximately 48 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.5, 10% glycerol, 1 mM TCEP.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
